340,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Ras-related protein Ral-B |
|---|
Gene and Protein Information
| Gene ID | 5899 |
|---|---|
| Uniprot Accession IDs | P11234 B4E040 Q53T32 Q6ZS74 |
| Ensembl ID | ENSP00000272519 |
| Family | Belongs to the small GTPase superfamily. Ras family. |
| Sequence | MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 64143 | Ralb | v-ral simian leukemia viral oncogene B | 10090 | MGI:1927244 | Inparanoid, OMA, EggNOG |
| Rat | 116546 | Ralb | RAS like proto-oncogene B | 10116 | RGD:619852 | Inparanoid, OMA |
| Dog | 483881 | RALB | RAS like proto-oncogene B | 9615 | VGNC:45331 | Inparanoid, OMA, EggNOG |
| Horse | 100060199 | RALB | RAS like proto-oncogene B | 9796 | VGNC:22160 | Inparanoid, OMA, EggNOG |
| Cow | 505238 | RALB | RAS like proto-oncogene B | 9913 | VGNC:33699 | Inparanoid, OMA, EggNOG |
| Pig | 100624229 | RALB | RAS like proto-oncogene B | 9823 | OMA, EggNOG | |
| Opossum | 100010449 | RALB | RAS like proto-oncogene B | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100563317 | ralb | RAS like proto-oncogene B | 28377 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 445255 | ralba | v-ral simian leukemia viral oncogene homolog Ba (ras related) | 7955 | ZDB-GENE-040801-267 | Inparanoid, OMA, EggNOG |
| C. elegans | 175433 | ral-1 | RAL (Ras-related GTPase) homolog | 6239 | Inparanoid, OMA |
Protein Classes
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.