340,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Pre-miRNA 5'-monophosphate methyltransferase |
|---|
Gene and Protein Information
| Gene ID | 144233 |
|---|---|
| Uniprot Accession IDs | Q7Z5W3 A8K829 |
| Ensembl ID | ENSP00000335201 |
| Family | Belongs to the methyltransferase superfamily. |
| Sequence | MAVPTELDGGSVKETAAEEESRVLAPGAAPFGNFPHYSRFHPPEQRLRLLPPELLRQLFPESPENGPILGLDVGCNSGDLSVALYKHFLSLPDGETCSDASREFRLLCCDIDPVLVKRAEKECPFPDALTFITLDFMNQRTRKVLLSSFLSQFGRSVFDIGFCMSITMWIHLNHGDHGLWEFLAHLSSLCHYLLVEPQPWKCYRAAARRLRKLGLHDFDHFHSLAIRGDMPNQIVQILTQDHGMELICCFGNTSWDRSLLLFRAKQTIETHPIPESLIEKGKEKNRLSFQKQ |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 741514 | BCDIN3D | BCDIN3 domain containing RNA methyltransferase | 9598 | VGNC:8348 | OMA, EggNOG |
| Macaque | 711559 | BCDIN3D | BCDIN3 domain containing RNA methyltransferase | 9544 | OMA, EggNOG | |
| Mouse | 75284 | Bcdin3d | BCDIN3 domain containing | 10090 | MGI:1922534 | OMA, EggNOG |
| Dog | 100685234 | BCDIN3D | BCDIN3 domain containing RNA methyltransferase | 9615 | VGNC:38404 | OMA, EggNOG |
| Horse | 100059723 | BCDIN3D | BCDIN3 domain containing RNA methyltransferase | 9796 | VGNC:15787 | OMA, EggNOG |
| Cow | 505650 | BCDIN3D | BCDIN3 domain containing RNA methyltransferase | 9913 | VGNC:26442 | OMA, EggNOG |
| Opossum | 100022774 | BCDIN3D | BCDIN3 domain containing RNA methyltransferase | 13616 | OMA, EggNOG | |
| Platypus | BCDIN3D | BCDIN3 domain containing RNA methyltransferase [Source:HGNC Symbol;Acc:HGNC:27050] | 9258 | OMA, EggNOG | ||
| Anole lizard | 100562802 | bcdin3d | BCDIN3 domain containing RNA methyltransferase | 28377 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.