🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS / CoA Structure Bulk & Custom
Menu
Account
Settings
྾
340,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

CDC20

DescriptionCell division cycle protein 20 homolog

Gene and Protein Information

Gene ID991
Uniprot Accession IDs Q12834 B2R6Z6 D3DPJ1 Q5JUY4 Q9BW56 Q9UQI9
Ensembl ID ENSP00000361540
Symbol CDC20A p55CDC bA276H19.3
FamilyBelongs to the WD repeat CDC20/Fizzy family.
Sequence
MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp456819CDC20cell division cycle 209598VGNC:472OMA, EggNOG
Macaque702317CDC20cell division cycle 209544Inparanoid, OMA, EggNOG
Mouse107995Cdc20cell division cycle 2010090MGI:1859866Inparanoid, OMA, EggNOG
Rat64515Cdc20cell division cycle 2010116RGD:620477Inparanoid, OMA, EggNOG
Dog100855774CDC20cell division cycle 209615VGNC:38987Inparanoid, OMA, EggNOG
Horse100053348CDC20cell division cycle 209796VGNC:16288Inparanoid, OMA, EggNOG
Cow515376CDC20cell division cycle 209913VGNC:27060Inparanoid, OMA, EggNOG
Pig397379CDC20cell division cycle 209823Inparanoid, OMA, EggNOG
PlatypusCDC20cell division cycle 20 [Source:HGNC Symbol;Acc:HGNC:1723]9258OMA, EggNOG
Chicken424563CDC20cell division cycle 209031CGNC:7578Inparanoid, OMA, EggNOG
Anole lizard100556314cdc20cell division cycle 2028377Inparanoid, OMA, EggNOG
Xenopus394542cdc20cell division cycle 208364XB-GENE-970663Inparanoid, OMA, EggNOG
Zebrafish406353cdc20cell division cycle 20 homolog7955ZDB-GENE-040426-2044Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.