🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS / CoA Structure Bulk & Custom
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

PRL

DescriptionProlactin

Gene and Protein Information

Gene ID5617
Uniprot Accession IDs P01236 Q15199 Q92996 PRL
Ensembl ID ENSP00000302150
Symbol GHA1
FamilyBelongs to the somatotropin/prolactin family.
Sequence
MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp462468PRLprolactin9598VGNC:3671OMA, EggNOG
Macaque707052PRLprolactin9544Inparanoid, OMA, EggNOG
Mouse19109Prlprolactin10090MGI:97762Inparanoid, OMA, EggNOG
Rat24683Prlprolactin10116RGD:3403Inparanoid, OMA, EggNOG
Dog488241PRLprolactin9615VGNC:44992Inparanoid, OMA, EggNOG
Horse100034034PRLprolactin9796Inparanoid, OMA, EggNOG
Cow280901PRLprolactin9913Inparanoid, OMA, EggNOG
Opossum100017831PRLprolactin13616Inparanoid, OMA, EggNOG
PlatypusPRLprolactin [Source:HGNC Symbol;Acc:HGNC:9445]9258OMA, EggNOG
Chicken396453PRLprolactin9031CGNC:9616Inparanoid, OMA, EggNOG
Anole lizard100561954prlprolactin28377Inparanoid, OMA, EggNOG
Xenopus100101709prl.1prolactin, gene 18364XB-GENE-482866Inparanoid, OMA
Zebrafish799612prl2prolactin 27955ZDB-GENE-041210-160Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    peptide hormone    /    Prolactin
protein    /    signaling molecule    /    growth factor    /    Prolactin
DTO Classes
protein    /    Signaling    /    Growth factor    /    Prolactin

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.