🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

TPMT

DescriptionThiopurine S-methyltransferase

Gene and Protein Information

Gene ID7172
Uniprot Accession IDs P51580 O14806 O15423 O15424 O15425 O15426 O15515 O15548 O43213 Q5VUK6 Q9UBE6 Q9UBT8 Q9UE62
Ensembl ID ENSP00000312304
Symbol TPMTD
FamilyBelongs to the class I-like SAM-binding methyltransferase superfamily. TPMT family.
Sequence
MDGTRTSLDIEEYSDTEVQKNQVLTLEEWQDKWVNGKTAFHQEQGHQLLKKHLDTFLKGKSGLRVFFPLCGKAVEMKWFADRGHSVVGVEISELGIQEFFTEQNLSYSEEPITEIPGTKVFKSSSGNISLYCCSIFDLPRTNIGKFDMIWDRGALVAINPGDRKCYADTMFSLLGKKFQYLLCVLSYDPTKHPGPPFYVPHAEIERLFGKICNIRCLEKVDAFEERHKSWGIDCLFEKLYLLTEK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp471863TPMTthiopurine S-methyltransferase9598VGNC:7936Inparanoid, OMA, EggNOG
Macaque704564TPMTthiopurine S-methyltransferase9544Inparanoid, OMA, EggNOG
Mouse22017Tpmtthiopurine methyltransferase10090MGI:98812Inparanoid, OMA, EggNOG
Dog403536TPMTthiopurine S-methyltransferase9615VGNC:47745Inparanoid, OMA, EggNOG
Horse100034066TPMTthiopurine S-methyltransferase9796VGNC:24436Inparanoid, OMA, EggNOG
Cow511644TPMTthiopurine S-methyltransferase9913VGNC:36255Inparanoid, OMA, EggNOG
Pig100157630TPMTthiopurine S-methyltransferase9823Inparanoid, OMA, EggNOG
Opossum100025242TPMTthiopurine S-methyltransferase13616Inparanoid, OMA, EggNOG
PlatypusTPMTthiopurine S-methyltransferase [Source:HGNC Symbol;Acc:HGNC:12014]9258OMA, EggNOG
Chicken420830TPMTthiopurine S-methyltransferase9031CGNC:9625Inparanoid, OMA, EggNOG
Xenopus549164tpmtthiopurine S-methyltransferase8364XB-GENE-941707Inparanoid, OMA, EggNOG
Zebrafish573111tpmt.2thiopurine S-methyltransferase, tandem duplicate 27955ZDB-GENE-041010-177OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.