Recombinant Human Factor VIII Protein

Cat. No.: rp217155
DISPONIBLE À COMMANDE
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE) See COA
Accession #
P00451
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Size
USA
Allemagne (EU)*
Price
Qty
10μg
rp217155-10μg
3 En stock
239,90$US
100μg
rp217155-100μg
Fabrication sur commande aux États-Unis · 2–4 semaines ·
959,90$US
1mg
rp217155-1mg
Fabrication sur commande aux États-Unis · 2–4 semaines ·
5 799,90$US
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,His-Tag,≥95%(SDS-PAGE),See COA Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human Factor VIII Protein
Synonymes
AHF | Antihemophilic factor | Coagulation factor VIII | coagulation factor VIII, procoagulant component | coagulation factor VIIIc | DXS1253E | F8 | F8b | F8c | FA8_HUMAN | factor VIII F8B | Factor VIIIa light chain | FactorVIII | FVIII | Hema | Hemophili
Grade
Carrier Free, His Tag
Spécifications et pureté
Carrier Free,His-Tag,≥95%(SDS-PAGE),See COA
Mécanismes biochimiques et physiologiques
Factor VIII, along with calcium and phospholipid, acts as a cofactor for factor IXa when it converts factor X to the activated form, factor Xa. Post-translational: Sulfation on Tyr-1699 is essential for binding vWF. Proteolytically cleaved by cathepsin
Concentration d'endotoxine
<1.0 EU/μg
Acides aminés
2144-2351 aa
Séquence
MHHHHHHVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY
Accession #
Poids moléculaire prévu
24.7 kDa
SDS-PAGE
25.1 kDa, under reducing conditions; 25.2 & 44.8 kDa, under non-reducing conditions.
Type de molécule
Protein
Stockage et expédition
Concentration
See COA
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Conditions de stockage de stockage
Store at -20°C,Avoid repeated freezing and thawing
Expédié en
Ice chest + Ice pads
Stabilité et stockage
Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images

Recombinant Human Factor VIII Protein (rp217155) - SDS-PAGE
2 μg/lane of Recombinant Human Factor VIII Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 25.1 kDa under reducing conditions and 25.2 & 44.8 kDa under non-reducing conditions.
Factor VIII, a non-covalent heterodimer comprised of a heavy chain (A1-A2-B domains) and light chain (A3-C1-C2 domains), circulates as an inactive procofactor in complex with von Willebrand factor (PMID: 16513527).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificats (CoA, COO, BSE/TSE et tableau d'analyse)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateArticle
ZJ26F0636049Certificate of AnalysisJun 05, 2026 rp217155
ZJ26F0636050Certificate of AnalysisJun 05, 2026 rp217155
ZJ26F0636051Certificate of AnalysisJun 05, 2026 rp217155
FAQ et articles
Calculateurs de solution
Avis

Avis des clients

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide → View His Tag grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.