Recombinant Human Fetuin A

Cat. No.: rp218458
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Low Endotoxin ? Low-endotoxin grade — endotoxin reduced to low controlled levels. Use in sensitive biological work where high endotoxin would interfere. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. for Cell culture ? Cell-culture grade — low endotoxin and contaminants to support viable cell growth. Use in mammalian/other cell culture media and supplements. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Accession #
P02765
Protein Tag
No tag
Expression system
CHO
Endotoxin Concentration
<0.5 EU/mg
Bioactivity
Measured in a cell proliferation assay using B16-F1 cells. Human Fetuin A stimulates adhesion of B16-F1 cells. The ED50 for this effect is 50-200 μg/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
100mg
rp218458-100mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$239.90
1g
rp218458-1g
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$1,779.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Low Endotoxin,High Performance,for cell culture,PBS Only,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,for Cell culture,High Performance,Low Endotoxin,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at 2-8°C Ships Wet ice Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human Fetuin A
Synonyms
alpha 2-Heremans-Schmid glycoprotein(AHSG),Alpha-2-Z-globulin, Ba-alpha-2-glycoprotein | A2HS | AHS | AHSG | alpha-2-HS-glycoprotein | alpha-2-Z-globulin | Ba-alpha-2-glycoprotein | FETUA | Fetuin A | fetuin-A | HSGA | APMR1 | alpha 2-Heremans-Schmid glyc
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, for Cell culture, High Performance, Low Endotoxin, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Low Endotoxin, High Performance, for cell culture, PBS Only, ≥95%(SDS-PAGE)
Biochemical and Physiological Mechanisms
Promotes endocytosis, possesses opsonic properties and influences the mineral phase of bone. Shows affinity for calcium and barium ions. Post-translational: Phosphorylation sites are present in the extracelllular medium.
Bioactivity
Measured in a cell proliferation assay using B16-F1 cells. Human Fetuin A stimulates adhesion of B16-F1 cells. The ED50 for this effect is 50-200 μg/mL.
Endotoxin Concentration
<0.5 EU/mg
Amino Acids
19-300 aa & 341-367 aa
Sequence
A-Chain: APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVL B-Chain: TVVQPSVGAAAGPVVPPCPGRIRHFKV
Accession #
Predicted molecular weight
32.9 KDa
Molecule Type
Protein
Storage and Shipping
Reconstitution
It is recommended to redissolve in sterile deionized water.
Storage
Store at 2-8°C
Shipped In
Wet ice
Stability And Storage
36 months at 2℃ to 8℃ in lyophilized state. 6 months at -20℃ to -80℃ under sterile conditions after reconstitution. 7-10 days at 2℃ to 8℃ under sterile conditions after reconstitution. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.