Recombinant Human FGF basic Protein

Cat. No.: rp228941
DISPONIBLE À COMMANDE
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. ≥95%(SDS-PAGE) expressed in E. coli; See COA
Accession #
P09038
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured in a cell proliferation assay using Balb‑3T3 mouse fibroblast cells. The ED50 for this effect is 4.021 ng/mL.
★
Size
USA
Allemagne (EU)*
Price
Qty
10μg
rp228941-10μg
Fabrication sur commande aux États-Unis · 2–4 semaines ·
—
69,90$US
50μg
rp228941-50μg
Fabrication sur commande aux États-Unis · 2–4 semaines ·
—
189,90$US
100μg
rp228941-100μg
Fabrication sur commande aux États-Unis · 2–4 semaines ·
—
229,90$US
1mg
rp228941-1mg
Fabrication sur commande aux États-Unis · 2–4 semaines ·
—
799,90$US
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,≥95%(SDS-PAGE),expressed in E. coli; See COA ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human FGF basic Protein
Synonymes
Basic fibroblast growth factor | Basic fibroblast growth factor bFGF | BFGF | FGF 2 | FGF B | FGF-2 | Fgf2 | FGF2 basic | FGF2_HUMAN | FGFB | Fibroblast growth factor 2 | Fibroblast growth factor 2 (basic) | Fibroblast growth factor, basic | HBGF 2 | HBGF
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance
Spécifications et pureté
Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,≥95%(SDS-PAGE),expressed in E. coli; See COA
Mécanismes biochimiques et physiologiques
FGF basic (also known as FGF2 and HBGF-2) is an 18-34 kDa, heparin-binding member of the FGF superfamily of molecules. Superfamily members are characterized by the presence of a centrally placed beta -trefoil structure. FGF acidic (FGF-1) and FGF basic (F
Bioactivité
Measured in a cell proliferation assay using Balb‑3T3 mouse fibroblast cells. The ED50 for this effect is 4.021 ng/mL.
Concentration d'endotoxine
<1.0 EU/μg
Acides aminés
143-288 aa
Séquence
APALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS​
Accession #
Poids moléculaire prévu
16.4 kDa
SDS-PAGE
16.5 kDa, under reducing conditions; 17.0 & 31.6 kDa, under non-reducing conditions
Type de molécule
Protein
Stockage et expédition
Concentration
expressed in E. coli; See COA
Conditions de stockage de stockage
Store at -20°C,Avoid repeated freezing and thawing
Expédié en
Ice chest + Ice pads
Stabilité et stockage
Store at -20℃ for 12 months. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images
Recombinant Human FGF basic Protein (rp228941) - Protein Bioactivity 
Measured in a cell proliferation assay using Balb‑3T3 mouse fibroblast cells. The ED50 for this effect is 4.021 ng/mL.
Recombinant Human FGF basic Protein (rp228941) - SDS-PAGE 
2 μg/lane of Recombinant Human FGF basic Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 16.5 kDa under reducing conditions and 17.0 & 31.6 kDa under non-reducing conditions. The observation of protein as both dimers and monomers under non-reducing (NR) conditions suggests that a portion of the protein forms dimers. This dimerization may be mediated by (or stabilized by) disulfide bonds (UniProt: P09038).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificats (CoA, COO, BSE/TSE et tableau d'analyse)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateArticle
ZJ26F0636406Certificate of AnalysisJun 12, 2026 rp228941
ZJ26F0636405Certificate of AnalysisJun 12, 2026 rp228941
ZJ26F0636407Certificate of AnalysisJun 12, 2026 rp228941
Calculateurs de solution
Avis

Avis des clients

Foire aux questions

What is the purity of this product, and how is it determined?
This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.
What does Animal Free mean?
Animal Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
What does Carrier Free mean?
Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
How should this product be stored?
Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.
How is this product shipped?
This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.
What documentation is provided?
Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.