Recombinant Human IL-2RG/CD132 Protein, ≥95% (SDS-PAGE)

Cat. No.: rp147543
DISPONIBLE À COMMANDE
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Accession #
P31785-1
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Measured by its ability to inhibit the IL-2-dependent proliferation of MO7e human megakaryocytic leukemic cells. The ED50 for this effect is typically 0.6-3.6 µg/mL in the presence of 30 µg/mL of soluble IL-2 R beta and 10 ng/mL of recombinant human IL-2.
★
Size
USA
Allemagne (EU)*
Price
Qty
10μg
rp147543-10μg
En stock ≥10
—
139,90$US
50μg
rp147543-50μg
3 En stock
—
399,90$US
100μg
rp147543-100μg
1 En stock
—
579,90$US
1mg
rp147543-1mg
Fabrication sur commande aux États-Unis · 2–4 semaines ·
—
3 799,90$US
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,His-Tag,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Vue d’ensemble

Purity

≥95% (SDS-PAGE)

Endotoxin level

<0.1 EU/μg

Function

Common subunit for the receptors for a variety of interleukins.

Specifications

Product Name
Recombinant Human IL-2RG/CD132 Protein, ≥95% (SDS-PAGE)
Synonymes
CD132 antigen | CD132 | CIDX | combined immunodeficiency, X-linked | common cytokine receptor gamma chain | Common gamma Chain | common gamma-chain | cytokine receptor common subunit gamma | gamma(c) | IL-2 R gamma | IL-2 receptor subunit gamma | IL2R gam
Grade
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance, His Tag
Spécifications et pureté
Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,His-Tag,≥95%(SDS-PAGE)
La pureté
≥95% (SDS-PAGE)
Bioactivité
Measured by its ability to inhibit the IL-2-dependent proliferation of MO7e human megakaryocytic leukemic cells. The ED50 for this effect is typically 0.6-3.6 µg/mL in the presence of 30 µg/mL of soluble IL-2 R beta and 10 ng/mL of recombinant human IL-2.
Concentration d'endotoxine
<0.1 EU/μg
Système d'expression
HEK293
Espèces
Human
Acides aminés
23-254 aa
Séquence
LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENHHHHHH
Journée des protéines
C-His
Accession #
Poids moléculaire prévu
26 kDa
SDS-PAGE
50 - 65 kDa, under reducing conditions; 50 - 65 kDa, under non-reducing conditions.
Type de molécule
Protein
Stockage et expédition
Forme
Lyophilized
Reconstitution
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml
Conditions de stockage de stockage
Store at -20°C,Avoid repeated freezing and thawing
Expédié en
Ice chest + Ice pads
Stabilité et stockage
Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images

Recombinant Human IL-2RG/CD132 Protein (rp147543) - SDS-PAGE
3 μg/lane of Recombinant Human IL-2RG/CD132 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 50 - 65 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificats (CoA, COO, BSE/TSE et tableau d'analyse)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

6 results found

Lot NumberCertificate TypeDateArticle
ZJ24F1215094Certificate of AnalysisAug 08, 2026 rp147543
ZJ24F1215095Certificate of AnalysisAug 08, 2026 rp147543
ZJ24F1215096Certificate of AnalysisAug 08, 2026 rp147543
ZJ24F0708594Certificate of AnalysisMar 13, 2026 rp147543
ZJ24F0708595Certificate of AnalysisMar 13, 2026 rp147543
ZJ24F0708596Certificate of AnalysisMar 13, 2026 rp147543
FAQ et articles
Calculateurs de solution
Avis

Avis des clients

Foire aux questions

What is the purity of this product, and how is it determined?
This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.
What does Animal Free mean?
Animal Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
What does Carrier Free mean?
Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
How should this product be stored?
Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.
How is this product shipped?
This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.
What documentation is provided?
Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.