Recombinant Mouse PF4 Protein

Cat. No.: rp329513
DISPONIBLE À COMMANDE
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥90%(SDS-PAGE)
Accession #
Q9Z126
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
★
Size
USA
Allemagne (EU)*
Price
Qty
10μg
rp329513-10μg
Sur commande · 8–12 semaines
99,90$US
50μg
rp329513-50μg
Sur commande · 8–12 semaines
299,90$US
100μg
rp329513-100μg
Sur commande · 8–12 semaines
479,90$US
1mg
rp329513-1mg
Sur commande · 8–12 semaines
2 399,90$US
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free, Carrier Free, His Tag, ≥90%(SDS-PAGE) Animal Free,Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Mouse PF4 Protein
Synonymes
Cxcl4 | Scyb4 | Pf4 | Platelet factor 4 | PF-4 | C-X-C motif chemokine 4
Grade
Animal Free, Carrier Free, His Tag
Spécifications et pureté
Animal Free, Carrier Free, His Tag, ≥90%(SDS-PAGE)
Mécanismes biochimiques et physiologiques
Chemokine released during platelet aggregation that plays a role in different biological processes including hematopoiesis, cell proliferation, differentiation, and activation. Acts via different functional receptors including CCR1, CXCR3A or CXCR3B. Upon
Concentration d'endotoxine
<1.0 EU/μg
Acides aminés
30-105 aa
Séquence
MHHHHHHVTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES
Accession #
Poids moléculaire prévu
13 kDa
SDS-PAGE
13 kDa, under reducing conditions.
Type de molécule
Protein
Stockage et expédition
Reconstitution
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Conditions de stockage de stockage
Store at -20°C,Avoid repeated freezing and thawing
Expédié en
Ice chest + Ice pads
Stabilité et stockage
Store at -20~-80℃ long term (1 year). Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificats (CoA, COO, BSE/TSE et tableau d'analyse)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
FAQ et articles
Calculateurs de solution
Avis

Avis des clients

Foire aux questions

What is the purity of this product, and how is it determined?
This product is supplied at ≥90% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.
What does Animal Free mean?
Animal Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
What does Carrier Free mean?
Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
How should this product be stored?
Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.
How is this product shipped?
This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.
What documentation is provided?
Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Animal Free grade guide → View Carrier Free grade guide → View His Tag grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.