Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Replication factor C subunit 4 |
|---|
Gene and Protein Information
| Gene ID | 5984 |
|---|---|
| Uniprot Accession IDs | P35249 B4DM41 D3DNV2 Q6FHX7 |
| Ensembl ID | ENSP00000376272 |
| Symbole | A1 RFC37 |
| Family | Belongs to the activator 1 small subunits family. |
| Sequence | MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVREKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLSQNC Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 100609026 | RFC4 | replication factor C subunit 4 | 9598 | VGNC:2535 | OMA, EggNOG |
| Macaque | 100426721 | RFC4 | replication factor C subunit 4 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 106344 | Rfc4 | replication factor C (activator 1) 4 | 10090 | MGI:2146571 | Inparanoid, OMA, EggNOG |
| Rat | 288003 | Rfc4 | replication factor C subunit 4 | 10116 | RGD:1310142 | Inparanoid, OMA, EggNOG |
| Dog | 478667 | RFC4 | replication factor C subunit 4 | 9615 | VGNC:45495 | Inparanoid, OMA, EggNOG |
| Horse | 100068189 | RFC4 | replication factor C subunit 4 | 9796 | VGNC:22321 | Inparanoid, OMA, EggNOG |
| Cow | 504637 | RFC4 | replication factor C subunit 4 | 9913 | VGNC:33888 | Inparanoid, OMA, EggNOG |
| Pig | 106504063 | RFC4 | replication factor C subunit 4 | 9823 | OMA, EggNOG | |
| Opossum | 100016281 | RFC4 | replication factor C subunit 4 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 424958 | RFC4 | replication factor C subunit 4 | 9031 | CGNC:6607 | Inparanoid, OMA |
| Anole lizard | 100561657 | rfc4 | replication factor C subunit 4 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 549117 | rfc4 | replication factor C subunit 4 | 8364 | XB-GENE-955724 | Inparanoid, OMA, EggNOG |
| Zebrafish | 406435 | rfc4 | replication factor C (activator 1) 4 | 7955 | ZDB-GENE-040824-3 | Inparanoid, OMA |
| C. elegans | 175976 | rfc-4 | Replication factor C subunit 4 | 6239 | Inparanoid, EggNOG | |
| Fruitfly | 32763 | CG8142 | CG8142 gene product from transcript CG8142-RA | 7227 | FBgn0030871 | Inparanoid, EggNOG |
| S.cerevisiae | 853531 | RFC2 | replication factor C subunit 2 | 4932 | S000003829 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / DNA-directed DNA polymerase / Replication factor C subunit 4
protein / nucleic acid binding / nucleotidyltransferase / Replication factor C subunit 4
protein / nucleic acid binding / DNA-directed DNA polymerase / Replication factor C subunit 4
protein / nucleic acid binding / nucleotidyltransferase / Replication factor C subunit 4
DTO Classes
protein / Enzyme / Transferase / Nucleotidyltransferase / Polymerase / DNA-directed DNA polymerase / Replication factor C subunit 4
protein / Enzyme / Transferase / Nucleotidyltransferase / Polymerase / DNA-directed DNA polymerase / Replication factor C subunit 4
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.