Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Interstitial collagenase |
|---|
Gene and Protein Information
| Gene ID | 4312 |
|---|---|
| Uniprot Accession IDs | P03956 P08156 |
| Ensembl ID | ENSP00000322788 |
| Symbole | CLG CLG CLGN |
| Family | Belongs to the peptidase M10A family. |
| Sequence | MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 451510 | MMP1 | matrix metallopeptidase 1 | 9598 | VGNC:1097 | OMA, EggNOG |
| Macaque | 703653 | MMP1 | matrix metallopeptidase 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 83996 | Mmp1b | matrix metallopeptidase 1b (interstitial collagenase) | 10090 | MGI:1933847 | Inparanoid, OMA, EggNOG |
| Rat | 300339 | Mmp1 | matrix metallopeptidase 1 | 10116 | RGD:1307917 | OMA, EggNOG |
| Dog | 489428 | MMP1 | matrix metallopeptidase 1 | 9615 | VGNC:43273 | Inparanoid, OMA, EggNOG |
| Horse | 100033896 | MMP1 | matrix metallopeptidase 1 | 9796 | VGNC:49488 | Inparanoid, OMA, EggNOG |
| Cow | 281308 | MMP1 | matrix metallopeptidase 1 (interstitial collagenase) | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | MMP3 | Interstitial collagenase 18 kDa interstitial collagenase [Source:UniProtKB/Swiss-Prot;Acc:P21692] | 9823 | Inparanoid, OMA, EggNOG | ||
| Opossum | 100012472 | LOC100012472 | interstitial collagenase | 13616 | OMA, EggNOG | |
| Platypus | 100078975 | LOC100078975 | interstitial collagenase | 9258 | OMA, EggNOG | |
| Chicken | 418982 | MMP1 | matrix metallopeptidase 1 | 9031 | CGNC:50888 | Inparanoid, OMA |
| Anole lizard | 100552848 | LOC100552848 | interstitial collagenase-like | 28377 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.