🌎 Livrer à: United States
Basculer la navigation
Panier
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

BRS3

DescriptionBombesin receptor subtype-3

Gene and Protein Information

Gene ID680
Uniprot Accession IDs P32247 BRS-3
Ensembl ID ENSP00000359682
Symbole BB3 BB3R
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MAQRQPHSPNQTLISITNDTESSSSVVSNDNTNKGWSGDNSPGIEALCAIYITYAVIISVGILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGRIGCKVLSFIRLTSVGVSVFTLTILSADRYKAVVKPLERQPSNAILKTCVKAGCVWIVSMIFALPEAIFSNVYTFRDPNKNMTFESCTSYPVSKKLLQEIHSLLCFLVFYIIPLSIISVYYSLIARTLYKSTLNIPTEEQSHARKQIESRKRIARTVLVLVALFALCWLPNHLLYLYHSFTSQTYVDPSAMHFIFTIFSRVLAFSNSCVNPFALYWLSKSFQKHFKAQLFCCKAERPEPPVADTSLTTLAVMGTVPGTGSIQMSEISVTSFTGCSVKQAEDRF
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp737980BRS3bombesin receptor subtype 39598VGNC:1410OMA, EggNOG
Mouse12209Brs3bombesin-like receptor 310090MGI:1100501Inparanoid, OMA, EggNOG
Rat260319Brs3bombesin receptor subtype 310116RGD:628645Inparanoid, OMA, EggNOG
Dog613002BRS3bombesin receptor subtype 39615VGNC:38535Inparanoid, OMA, EggNOG
Horse100054718BRS3bombesin receptor subtype 39796VGNC:15898Inparanoid, OMA, EggNOG
Cow539011BRS3bombesin receptor subtype 39913VGNC:26574Inparanoid, OMA, EggNOG
Opossum100009904BRS3bombesin receptor subtype 313616Inparanoid, OMA, EggNOG
Platypus100083667BRS3bombesin receptor subtype 39258Inparanoid, OMA, EggNOG
Xenopus100488712brs3bombesin like receptor 38364XB-GENE-960289Inparanoid, OMA
Fruitfly35535CCHa2-RCCHamide-2 receptor7227FBgn0033058Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Bombesin receptor    /    Bombesin receptor subtype-3

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Nous utilisons des cookies pour garantir le bon fonctionnement du site et, lorsque cela est autorisé, pour améliorer votre expérience. Vous pouvez gérer vos préférences à tout moment dans les Paramètres. Pour en savoir plus, consultez notre Politique relative aux cookies.

      Souhaitez-vous que nous vous envoyions un message lorsque des réductions seront disponibles?

      Me rappeler plus tard

      Merci ! Veuillez vérifier votre boîte de réception e-mail pour confirmer.

      Oups ! Les notifications sont désactivées.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.