🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS CoA Structure
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

ALOX5AP

DescriptionArachidonate 5-lipoxygenase-activating protein

Gene and Protein Information

Gene ID241
Uniprot Accession IDs P20292 Q5VV04
Ensembl ID ENSP00000479870
Symbole FLAP FLAP
FamilyBelongs to the MAPEG family.
Sequence
MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp452520ALOX5AParachidonate 5-lipoxygenase activating protein9598VGNC:7283OMA, EggNOG
Macaque713170ALOX5AParachidonate 5-lipoxygenase activating protein9544Inparanoid, OMA, EggNOG
Mouse11690Alox5aparachidonate 5-lipoxygenase activating protein10090MGI:107505Inparanoid, OMA, EggNOG
Rat29624Alox5aparachidonate 5-lipoxygenase activating protein10116RGD:2097Inparanoid, OMA, EggNOG
DogALOX5AParachidonate 5-lipoxygenase activating protein [Source:HGNC Symbol;Acc:HGNC:436]9615OMA, EggNOG
Horse100034178ALOX5AParachidonate 5-lipoxygenase activating protein9796Inparanoid, OMA, EggNOG
Cow613869ALOX5AParachidonate 5-lipoxygenase activating protein9913VGNC:25845Inparanoid, OMA, EggNOG
Pig397392ALOX5AParachidonate 5-lipoxygenase activating protein9823Inparanoid, OMA, EggNOG
Opossum100026200ALOX5AParachidonate 5-lipoxygenase activating protein13616Inparanoid, OMA, EggNOG
Platypus100079414ALOX5AParachidonate 5-lipoxygenase activating protein9258Inparanoid, OMA, EggNOG
Chicken770904ALOX5AParachidonate 5-lipoxygenase activating protein9031CGNC:66655Inparanoid, OMA
Anole lizard100560510alox5aparachidonate 5-lipoxygenase activating protein28377Inparanoid, OMA, EggNOG
Xenopus613083alox5aparachidonate 5-lipoxygenase activating protein8364XB-GENE-492422Inparanoid, OMA, EggNOG
Zebrafish337376alox5aparachidonate 5-lipoxygenase-activating protein7955ZDB-GENE-030131-9322Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.