Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Integrator complex subunit 9 |
|---|
Gene and Protein Information
| Gene ID | 55756 |
|---|---|
| Uniprot Accession IDs | Q9NV88 B7Z560 B7Z6M5 O00224 Q8TB16 Int9 |
| Ensembl ID | ENSP00000429065 |
| Symbole | RC74 INT9 RC74 CPSF2L |
| Family | Belongs to the metallo-beta-lactamase superfamily. RNA-metabolizing metallo-beta-lactamase-like family. INTS9 subfamily. |
| Sequence | MKLYCLSGHPTLPCNVLKFKSTTIMLDCGLDMTSTLNFLPLPLVQSPRLSNLPGWSLKDGNAFLDKELKECSGHVFVDSVPEFCLPETELIDLSTVDVILISNYHCMMALPYITEHTGFTGTVYATEPTVQIGRLLMEELVNFIERVPKAQSASLWKNKDIQRLLPSPLKDAVEVSTWRRCYTMQEVNSALSKIQLVGYSQKIELFGAVQVTPLSSGYALGSSNWIIQSHYEKVSYVSGSSLLTTHPQPMDQASLKNSDVLVLTGLTQIPTANPDGMVGEFCSNLALTVRNGGNVLVPCYPSGVIYDLLECLYQYIDSAGLSSVPLYFISPVANSSLEFSQIFAEWLCHNKQSKVYLPEPPFPHAELIQTNKLKHYPSIHGDFSNDFRQPCVVFTGHPSLRFGDVVHFMELWGKSSLNTVIFTEPDFSYLEALAPYQPLAMKCIYCPIDTRLNFIQVSKLLKEVQPLHVVCPEQYTQPPPAQSHRMDLMIDCQPPAMSYRRAEVLALPFKRRYEKIEIMPELADSLVPMEIKPGISLATVSAVLHTKDNKHLLQPPPRPAQPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFVQTLEKHGFSDIKVEDTAKGHIVLLQEAETLIQIEEDSTHIICDNDEMLRVRLRDLVLKFLQKF Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 745212 | INTS9 | integrator complex subunit 9 | 9598 | VGNC:859 | OMA, EggNOG |
| Macaque | 718598 | INTS9 | integrator complex subunit 9 | 9544 | OMA, EggNOG | |
| Mouse | 210925 | Ints9 | integrator complex subunit 9 | 10090 | MGI:1098533 | Inparanoid, OMA, EggNOG |
| Rat | 290322 | Ints9 | integrator complex subunit 9 | 10116 | RGD:1311539 | Inparanoid, OMA, EggNOG |
| Dog | 486090 | INTS9 | integrator complex subunit 9 | 9615 | VGNC:42058 | Inparanoid, OMA, EggNOG |
| Horse | 100061398 | INTS9 | integrator complex subunit 9 | 9796 | VGNC:19097 | Inparanoid, OMA, EggNOG |
| Cow | 533964 | INTS9 | integrator complex subunit 9 | 9913 | VGNC:30234 | Inparanoid, OMA, EggNOG |
| Pig | 100155552 | INTS9 | integrator complex subunit 9 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100033173 | INTS9 | integrator complex subunit 9 | 13616 | Inparanoid, EggNOG | |
| Chicken | 422023 | INTS9 | integrator complex subunit 9 | 9031 | CGNC:12464 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100557312 | ints9 | integrator complex subunit 9 | 28377 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 768124 | ints9 | integrator complex subunit 9 | 7955 | ZDB-GENE-061013-129 | Inparanoid, OMA, EggNOG |
| C. elegans | 179142 | F19F10.12 | hypothetical protein | 6239 | OMA, EggNOG | |
| Fruitfly | 39763 | IntS9 | Integrator 9 | 7227 | FBgn0036570 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.