Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | P2Y purinoceptor 6 |
|---|
Gene and Protein Information
| Gene ID | 5031 |
|---|---|
| Uniprot Accession IDs | Q15077 Q15754 P2Y6 |
| Ensembl ID | ENSP00000480966 |
| Symbole | P2Y6 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTRTAVYTLNLALADLLYACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCISFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQCLPTAIFAATGIQRNRTVCYDLSPPALATHYMPYGMALTVIGFLLPFAALLACYCLLACRLCRQDGPAEPVAQERRGKAARMAVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPILFYFTQKKFRRRPHELLQKLTAKWQRQGR Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 451410 | P2RY6 | pyrimidinergic receptor P2Y6 | 9598 | VGNC:7510 | OMA, EggNOG |
| Macaque | 718623 | P2RY6 | pyrimidinergic receptor P2Y6 | 9544 | Inparanoid, OMA | |
| Mouse | 233571 | P2ry6 | pyrimidinergic receptor P2Y, G-protein coupled, 6 | 10090 | MGI:2673874 | Inparanoid, OMA, EggNOG |
| Rat | 117264 | P2ry6 | pyrimidinergic receptor P2Y6 | 10116 | RGD:620269 | Inparanoid, OMA, EggNOG |
| Dog | 485202 | P2RY6 | pyrimidinergic receptor P2Y6 | 9615 | VGNC:44218 | Inparanoid, OMA, EggNOG |
| Cow | 539703 | P2RY6 | pyrimidinergic receptor P2Y6 | 9913 | VGNC:32530 | Inparanoid, OMA, EggNOG |
| Pig | 100512849 | P2RY6 | pyrimidinergic receptor P2Y6 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | P2RY6 | pyrimidinergic receptor P2Y6 [Source:HGNC Symbol;Acc:HGNC:8543] | 13616 | Inparanoid, OMA, EggNOG | ||
| Chicken | 396114 | P2RY6 | pyrimidinergic receptor P2Y6 | 9031 | CGNC:13017 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100552148 | p2ry6 | pyrimidinergic receptor P2Y6 | 28377 | Inparanoid, OMA, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Purinoceptor / P2Y receptor / P2y purinoceptor 6
protein / G-protein coupled receptor / Class A rhodopsin like / Purinoceptor / P2Y receptor / P2y purinoceptor 6
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.