🌎 Livrer à: United States
Basculer la navigation
Panier
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

PPAT

DescriptionAmidophosphoribosyltransferase

Gene and Protein Information

Gene ID5471
Uniprot Accession IDs Q06203 ATase
Ensembl ID ENSP00000264220
Symbole GPAT GPAT PRAT ATASE
FamilyIn the C-terminal section; belongs to the purine/pyrimidine phosphoribosyltransferase family.
Sequence
MELEELGIREECGVFGCIASGEWPTQLDVPHVITLGLVGLQHRGQESAGIVTSDGSSVPTFKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKCELENCQPFVVETLHGKIAVAHNGELVNAARLRKKLLRHGIGLSTSSDSEMITQLLAYTPPQEQDDTPDWVARIKNLMKEAPTAYSLLIMHRDVIYAVRDPYGNRPLCIGRLIPVSDINDKEKKTSETEGWVVSSESCSFLSIGARYYREVLPGEIVEISRHNVQTLDIISRSEGNPVAFCIFEYVYFARPDSMFEDQMVYTVRYRCGQQLAIEAPVDADLVSTVPESATPAALAYAGKCGLPYVEVLCKNRYVGRTFIQPNMRLRQLGVAKKFGVLSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASPPIKYPCFMGINIPTKEELIANKPEFDHLAEYLGANSVVYLSVEGLVSSVQEGIKFKKQKEKKHDIMIQENGNGLECFEKSGHCTACLTGKYPVELEW
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp461309PPATphosphoribosyl pyrophosphate amidotransferase9598VGNC:667OMA, EggNOG
Macaque694868PPATphosphoribosyl pyrophosphate amidotransferase9544Inparanoid, OMA, EggNOG
Mouse231327Ppatphosphoribosyl pyrophosphate amidotransferase10090MGI:2387203Inparanoid, OMA, EggNOG
Rat117544Ppatphosphoribosyl pyrophosphate amidotransferase10116RGD:620237Inparanoid, OMA, EggNOG
Dog611407PPATphosphoribosyl pyrophosphate amidotransferase9615VGNC:44839Inparanoid, OMA, EggNOG
Horse100053805PPATphosphoribosyl pyrophosphate amidotransferase9796VGNC:21719Inparanoid, OMA, EggNOG
Cow509652PPATphosphoribosyl pyrophosphate amidotransferase9913VGNC:33186Inparanoid, OMA, EggNOG
Pig100522503PPATphosphoribosyl pyrophosphate amidotransferase9823Inparanoid, OMA, EggNOG
Opossum107649340PPATphosphoribosyl pyrophosphate amidotransferase13616Inparanoid, OMA, EggNOG
Chicken422743PPATphosphoribosyl pyrophosphate amidotransferase9031CGNC:10276Inparanoid, OMA, EggNOG
Anole lizard100553317ppatphosphoribosyl pyrophosphate amidotransferase28377Inparanoid, OMA, EggNOG
Xenopus394937ppatphosphoribosyl pyrophosphate amidotransferase8364XB-GENE-972203Inparanoid, OMA, EggNOG
Zebrafish572027ppatphosphoribosyl pyrophosphate amidotransferase7955ZDB-GENE-041210-323Inparanoid, OMA, EggNOG
C. elegans175613ppat-1Amidophosphoribosyltransferase6239OMA, EggNOG
S.cerevisiae855346ADE4amidophosphoribosyltransferase4932S000004915Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Nous utilisons des cookies pour garantir le bon fonctionnement du site et, lorsque cela est autorisé, pour améliorer votre expérience. Vous pouvez gérer vos préférences à tout moment dans les Paramètres. Pour en savoir plus, consultez notre Politique relative aux cookies.

      Souhaitez-vous que nous vous envoyions un message lorsque des réductions seront disponibles?

      Me rappeler plus tard

      Merci ! Veuillez vérifier votre boîte de réception e-mail pour confirmer.

      Oups ! Les notifications sont désactivées.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.