🌎 Livrer à: United States
Basculer la navigation
Panier
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

CNR2

DescriptionCannabinoid receptor 2

Gene and Protein Information

Gene ID1269
Uniprot Accession IDs P34972 C6ES44 Q4VBK8 Q5JRH7 Q6B0G7 Q6NSY0 CB-2
Ensembl ID ENSP00000363596
Symbole CB2A CB2B CB2 CX5 CB-2
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp456625CNR2cannabinoid receptor 29598VGNC:6114OMA, EggNOG
Macaque711155CNR2cannabinoid receptor 29544Inparanoid, OMA, EggNOG
Mouse12802Cnr2cannabinoid receptor 2 (macrophage)10090MGI:104650Inparanoid, OMA, EggNOG
Rat57302Cnr2cannabinoid receptor 210116RGD:619713Inparanoid, OMA, EggNOG
Dog612289CNR2cannabinoid receptor 29615VGNC:39427Inparanoid, OMA, EggNOG
Horse100071536CNR2cannabinoid receptor 29796VGNC:16688Inparanoid, OMA, EggNOG
Cow539769CNR2cannabinoid receptor 29913VGNC:27530Inparanoid, OMA, EggNOG
Pig100621002CNR2cannabinoid receptor 29823OMA, EggNOG
Opossum100010312CNR2cannabinoid receptor 213616Inparanoid, OMA, EggNOG
Platypus100091779CNR2cannabinoid receptor 29258Inparanoid, OMA, EggNOG
Chicken428232CNR2cannabinoid receptor 29031CGNC:3023Inparanoid, EggNOG
Anole lizard100563830cnr2cannabinoid receptor 228377Inparanoid, OMA, EggNOG
Xenopus100498271cnr2cannabinoid receptor 28364XB-GENE-488004Inparanoid, OMA, EggNOG
Zebrafish795246cnr2cannabinoid receptor 27955ZDB-GENE-040702-7OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Cannabinoid receptor 2
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Cannabinoid receptor    /    Cannabinoid receptor 2

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpécificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Nous utilisons des cookies pour garantir le bon fonctionnement du site et, lorsque cela est autorisé, pour améliorer votre expérience. Vous pouvez gérer vos préférences à tout moment dans les Paramètres. Pour en savoir plus, consultez notre Politique relative aux cookies.

      Souhaitez-vous que nous vous envoyions un message lorsque des réductions seront disponibles?

      Me rappeler plus tard

      Merci ! Veuillez vérifier votre boîte de réception e-mail pour confirmer.

      Oups ! Les notifications sont désactivées.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.