Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | U2 small nuclear ribonucleoprotein B'' |
|---|
Gene and Protein Information
| Gene ID | 6629 |
|---|---|
| Uniprot Accession IDs | P08579 B2R7J3 D3DW21 Q9UJD4 U2 snRNP B'' |
| Ensembl ID | ENSP00000246071 |
| Symbole | Msl1 U2B'' |
| Family | Belongs to the RRM U1 A/B'' family. |
| Sequence | MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 458105 | SNRPB2 | small nuclear ribonucleoprotein polypeptide B2 | 9598 | VGNC:9995 | OMA, EggNOG |
| Mouse | 20639 | Snrpb2 | U2 small nuclear ribonucleoprotein B | 10090 | MGI:104805 | OMA, EggNOG |
| Rat | 362223 | Snrpb2 | small nuclear ribonucleoprotein polypeptide B2 | 10116 | RGD:1310194 | OMA, EggNOG |
| Dog | 477148 | SNRPB2 | small nuclear ribonucleoprotein polypeptide B2 | 9615 | OMA, EggNOG | |
| Horse | 100050830 | SNRPB2 | small nuclear ribonucleoprotein polypeptide B2 | 9796 | VGNC:23396 | OMA, EggNOG |
| Cow | 767873 | SNRPB2 | small nuclear ribonucleoprotein polypeptide B2 | 9913 | VGNC:35077 | OMA, EggNOG |
| Platypus | 100078690 | SNRPB2 | small nuclear ribonucleoprotein polypeptide B2 | 9258 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / mRNA splicing factor / U2 small nuclear ribonucleoprotein B''
protein / nucleic acid binding / mRNA splicing factor / U2 small nuclear ribonucleoprotein B''
DTO Classes
protein / Nucleic acid binding / RNA binding protein / mRNA processing factor / mRNA splicing factor / U2 small nuclear ribonucleoprotein B''
protein / Nucleic acid binding / RNA binding protein / mRNA processing factor / mRNA splicing factor / U2 small nuclear ribonucleoprotein B''
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.