🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS CoA Structure
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

CTRL

DescriptionChymotrypsin-like protease CTRL-1

Gene and Protein Information

Gene ID1506
Uniprot Accession IDs P40313
Ensembl ID ENSP00000458537
Symbole CTRL1 CTRL1
FamilyBelongs to the peptidase S1 family.
Sequence
MLLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp454179CTRLchymotrypsin like9598VGNC:9027OMA, EggNOG
Macaque701625CTRLchymotrypsin like9544Inparanoid, OMA, EggNOG
Mouse109660Ctrlchymotrypsin-like10090MGI:88558Inparanoid, OMA, EggNOG
Rat117184Ctrlchymotrypsin-like10116RGD:621501Inparanoid, OMA, EggNOG
Dog611100CTRLchymotrypsin like9615VGNC:39707Inparanoid, OMA, EggNOG
Pig100621609CTRLchymotrypsin like9823OMA, EggNOG
Opossum100021711CTRLchymotrypsin like13616Inparanoid, EggNOG
PlatypusCTRLchymotrypsin like [Source:HGNC Symbol;Acc:HGNC:2524]9258OMA, EggNOG
Anole lizard100554181ctrlchymotrypsin like28377Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.