SUCNR1

DescriptionSuccinate receptor 1

Gene and Protein Information

Gene ID56670
Uniprot Accession IDs Q9BXA5 A8K305 Q8TDQ8
Ensembl ID ENSP00000355156
Symbole GPR91 GPR91
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MLGIMAWNATCKNWLAAEAALEKYYLSIFYGIEFVVGVLGNTIVVYGYIFSLKNWNSSNIYLFNLSVSDLAFLCTLPMLIRSYANGNWIYGDVLCISNRYVLHANLYTSILFLTFISIDRYLIIKYPFREHLLQKKEFAILISLAIWVLVTLELLPILPLINPVITDNGTTCNDFASSGDPNYNLIYSMCLTLLGFLIPLFVMCFFYYKIALFLKQRNRQVATALPLEKPLNLVIMAVVIFSVLFTPYHVMRNVRIASRLGSWKQYQCTQVVINSFYIVTRPLAFLNSVINPVFYFLLGDHFRDMLMNQLRHNFKSLTSFSRWAHELLLSFREK
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp738824SUCNR1succinate receptor 19598VGNC:12200OMA, EggNOG
Mouse84112Sucnr1succinate receptor 110090MGI:1934135Inparanoid, OMA, EggNOG
Rat408199Sucnr1succinate receptor 110116RGD:1303193Inparanoid, OMA, EggNOG
Dog485719SUCNR1succinate receptor 19615VGNC:46968Inparanoid, OMA, EggNOG
Horse100056372SUCNR1succinate receptor 19796VGNC:23745Inparanoid, OMA, EggNOG
Cow539622SUCNR1succinate receptor 19913VGNC:35458OMA, EggNOG
Pig100739158SUCNR1succinate receptor 19823OMA, EggNOG
Platypus100083905SUCNR1succinate receptor 19258OMA, EggNOG
Chicken771768SUCNR1succinate receptor 19031CGNC:7886Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Succinate receptor 1

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.