🌎 Livrer à: United States
Basculer la navigation
Panier
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

FFAR2

DescriptionFree fatty acid receptor 2

Gene and Protein Information

Gene ID2867
Uniprot Accession IDs O15552 B0M0J9 Q4VAZ3 Q4VAZ5 Q4VBL5
Ensembl ID ENSP00000473159
Symbole FFA2 GPCR43 GPR43 FFA2R GPR43
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLLLLPFKIIEAASNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLSRRPLYGVIAALVAWVMSFGHCTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVRLELCLVLFFIPMAVTIFCYWRFVWIMLSQPLVGAQRRRRAVGLAVVTLLNFLVCFGPYNVSHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp455948FFAR2free fatty acid receptor 29598VGNC:11096OMA, EggNOG
Macaque709026FFAR2free fatty acid receptor 29544Inparanoid, OMA, EggNOG
Mouse233079Ffar2free fatty acid receptor 210090MGI:2441731Inparanoid, OMA, EggNOG
Rat292794Ffar2free fatty acid receptor 210116RGD:1359614Inparanoid, OMA, EggNOG
Dog484580FFAR2free fatty acid receptor 29615VGNC:40831Inparanoid, OMA, EggNOG
Horse100059449FFAR2free fatty acid receptor 29796VGNC:51028Inparanoid, OMA, EggNOG
Cow522431FFAR2free fatty acid receptor 29913OMA, EggNOG
Opossum100015816FFAR2free fatty acid receptor 213616Inparanoid, OMA, EggNOG
PlatypusFFAR2free fatty acid receptor 2 [Source:HGNC Symbol;Acc:HGNC:4501]9258OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Free fatty acid receptor    /    Free fatty acid receptor 2

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpécificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Nous utilisons des cookies pour garantir le bon fonctionnement du site et, lorsque cela est autorisé, pour améliorer votre expérience. Vous pouvez gérer vos préférences à tout moment dans les Paramètres. Pour en savoir plus, consultez notre Politique relative aux cookies.

      Souhaitez-vous que nous vous envoyions un message lorsque des réductions seront disponibles?

      Me rappeler plus tard

      Merci ! Veuillez vérifier votre boîte de réception e-mail pour confirmer.

      Oups ! Les notifications sont désactivées.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.