IL9

DescriptionInterleukin-9

Gene and Protein Information

Gene ID3578
Uniprot Accession IDs P15248 IL-9
Ensembl ID ENSP00000274520
Symbole P40 HP40 IL-9
FamilyBelongs to the IL-7/IL-9 family.
Sequence
MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp745517IL9interleukin 99598VGNC:13518OMA, EggNOG
Macaque712292IL9interleukin 99544Inparanoid, OMA, EggNOG
Mouse16198Il9interleukin 910090MGI:96563Inparanoid, OMA, EggNOG
Rat116558Il9interleukin 910116RGD:620049Inparanoid, OMA, EggNOG
HorseIL9interleukin 9 [Source:HGNC Symbol;Acc:HGNC:6029]9796OMA, EggNOG
Cow613392IL9interleukin 99913VGNC:30171Inparanoid, OMA, EggNOG
Pig100144594IL9interleukin 99823Inparanoid, OMA, EggNOG
Opossum103105574IL9interleukin 913616Inparanoid, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.