🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

TNFRSF12A

DescriptionTumor necrosis factor receptor superfamily member 12A

Gene and Protein Information

Gene ID51330
Uniprot Accession IDs Q9NP84 D3DUA6 Q9HCS0
Ensembl ID ENSP00000326737
Symbole FN14 FN14 CD266 TWEAKR
Sequence
MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp107968771TNFRSF12ATNF receptor superfamily member 12A9598VGNC:5943OMA, EggNOG
Mouse27279Tnfrsf12atumor necrosis factor receptor superfamily, member 12a10090MGI:1351484Inparanoid, OMA, EggNOG
Rat302965Tnfrsf12aTNF receptor superfamily member 12A10116RGD:631329Inparanoid, OMA, EggNOG
Dog610734TNFRSF12ATNF receptor superfamily member 12A9615VGNC:47656Inparanoid, OMA, EggNOG
Horse100146755TNFRSF12ATNF receptor superfamily member 12A9796VGNC:24365Inparanoid, OMA, EggNOG
Cow617439TNFRSF12ATNF receptor superfamily member 12A9913VGNC:36162Inparanoid, OMA, EggNOG
Pig100217390TNFRSF12ATNF receptor superfamily member 12A9823Inparanoid, OMA, EggNOG
Opossum100017750TNFRSF12ATNF receptor superfamily member 12A13616Inparanoid, OMA, EggNOG
PlatypusTNFRSF12ATNF receptor superfamily member 12A [Source:HGNC Symbol;Acc:HGNC:18152]9258OMA, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.