🌎 Livrer à: United States
Basculer la navigation
Panier
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

TPSAB1

DescriptionTryptase alpha/beta-1

Gene and Protein Information

Gene ID7177
Uniprot Accession IDs Q15661 D2E6R9 D2E6S1 P15157 Q15663 Q6B052 Q9H2Y4 Q9H2Y5 Q9UQI1 Tryptase-1
Ensembl ID ENSP00000343577
Symbole TPS1 TPS2 TPSB1 TPS1 TPS2 TPSB1 TPSB2 Tryptase-2
FamilyBelongs to the peptidase S1 family. Tryptase subfamily.
Sequence
MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp468084LOC468084tryptase alpha/beta-1-like9598OMA, EggNOG
Macaque699599LOC699599tryptase alpha/beta-19544OMA, EggNOG
Mouse17229Tpsb2tryptase beta 210090MGI:96942OMA, EggNOG
Rat54271Tpsab1tryptase alpha/beta 110116RGD:3066OMA, EggNOG
Horse100033966RETret proto-oncogene9796OMA, EggNOG
Cow786948LOC786948tryptase-2-like9913OMA, EggNOG
Opossum100022090LOC100022090tryptase alpha/beta-1-like13616OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    peptide hormone    /    Tryptase alpha/beta-1
protein    /    calcium-binding protein    /    serine protease    /    Tryptase alpha/beta-1
protein    /    calcium-binding protein    /    protease inhibitor    /    Tryptase alpha/beta-1
protein    /    calcium-binding protein    /    calmodulin    /    Tryptase alpha/beta-1
protein    /    calcium-binding protein    /    annexin    /    Tryptase alpha/beta-1
protein    /    calcium-binding protein    /    receptor    /    Tryptase alpha/beta-1
DTO Classes
protein    /    Enzyme    /    Protease    /    Serine protease    /    Tryptase alpha/beta-1

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpécificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Nous utilisons des cookies pour garantir le bon fonctionnement du site et, lorsque cela est autorisé, pour améliorer votre expérience. Vous pouvez gérer vos préférences à tout moment dans les Paramètres. Pour en savoir plus, consultez notre Politique relative aux cookies.

      Souhaitez-vous que nous vous envoyions un message lorsque des réductions seront disponibles?

      Me rappeler plus tard

      Merci ! Veuillez vérifier votre boîte de réception e-mail pour confirmer.

      Oups ! Les notifications sont désactivées.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.