Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Sphingosine 1-phosphate receptor 1 |
|---|
Gene and Protein Information
| Gene ID | 1901 |
|---|---|
| Uniprot Accession IDs | P21453 D3DT66 Q9BYY4 Q9NYN8 S1P receptor 1 |
| Ensembl ID | ENSP00000305416 |
| Symbole | CHEDG1 EDG1 EDG1 S1P1 CD363 ECGF1 EDG-1 CHEDG1 D1S3362 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 457063 | S1PR1 | sphingosine-1-phosphate receptor 1 | 9598 | VGNC:8100 | OMA, EggNOG |
| Mouse | 13609 | S1pr1 | sphingosine-1-phosphate receptor 1 | 10090 | MGI:1096355 | Inparanoid, OMA, EggNOG |
| Rat | 29733 | S1pr1 | sphingosine-1-phosphate receptor 1 | 10116 | RGD:61958 | Inparanoid, OMA, EggNOG |
| Dog | 490138 | S1PR1 | sphingosine-1-phosphate receptor 1 | 9615 | VGNC:45836 | Inparanoid, OMA |
| Horse | 100050049 | S1PR1 | sphingosine-1-phosphate receptor 1 | 9796 | VGNC:22660 | Inparanoid, OMA, EggNOG |
| Cow | 281135 | S1PR1 | sphingosine-1-phosphate receptor 1 | 9913 | VGNC:34252 | Inparanoid, OMA, EggNOG |
| Pig | 100621202 | S1PR1 | sphingosine-1-phosphate receptor 1 | 9823 | OMA, EggNOG | |
| Opossum | 100032972 | S1PR1 | sphingosine-1-phosphate receptor 1 | 13616 | Inparanoid, OMA | |
| Platypus | S1PR1 | sphingosine-1-phosphate receptor 1 [Source:HGNC Symbol;Acc:HGNC:3165] | 9258 | OMA, EggNOG | ||
| Anole lizard | 100557814 | LOC100557814 | uncharacterized oxidoreductase ZK1290.5 | 28377 | Inparanoid, OMA | |
| Xenopus | 780355 | s1pr1 | sphingosine-1-phosphate receptor 1 | 8364 | XB-GENE-977003 | Inparanoid, OMA, EggNOG |
| Zebrafish | 64617 | s1pr1 | sphingosine-1-phosphate receptor 1 | 7955 | ZDB-GENE-001228-2 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / receptor / G-protein coupled receptor / Sphingosine 1-phosphate receptor 1
protein / receptor / G-protein coupled receptor / Sphingosine 1-phosphate receptor 1
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Sphingosine 1-phosphate receptor 1
protein / G-protein coupled receptor / Class A rhodopsin like / Sphingosine 1-phosphate receptor 1
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.