Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Solute carrier family 5 member 4 |
|---|
Gene and Protein Information
| Gene ID | 6527 |
|---|---|
| Uniprot Accession IDs | Q9NY91 O15279 |
| Ensembl ID | ENSP00000266086 |
| Symbole | SAAT1 SGLT3 SAAT1 SGLT3 DJ90G24.4 |
| Family | Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family. |
| Sequence | MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKTNRGTIGGFFLAGRDMAWWPMGASLFASNIGSNHYVGLAGTGAASGVATVTFEWTSSVMLLILGWIFVPIYIKSGVMTMPEYLKKRFGGERLQVYLSILSLFICVVLLISADIFAGAIFIKLALGLDLYLAIFILLAMTAVYTTTGGLASVIYTDTLQTIIMLIGSFILMGFAFNEVGGYESFTEKYVNATPSVVEGDNLTISASCYTPRADSFHIFRDAVTGDIPWPGIIFGMPITALWYWCTNQVIVQRCLCGKDMSHVKAACIMCAYLKLLPMFLMVMPGMISRILYTDMVACVVPSECVKHCGVDVGCTNYAYPTMVLELMPQGLRGLMLSVMLASLMSSLTSIFNSASTLFTIDLYTKMRKQASEKELLIAGRIFVLLLTVVSIVWVPLVQVSQNGQLIHYTESISSYLGPPIAAVFVLAIFCKRVNEQGAFWGLMVGLAMGLIRMITEFAYGTGSCLAPSNCPKIICGVHYLYFSIVLFFGSMLVTLGISLLTKPIPDVHLYRLCWVLRNSTEERIDIDAEEKSQEETDDGVEEDYPEKSRGCLKKAYDLFCGLQKGPKLTKEEEEALSKKLTDTSERPSWRTIVNINAILLLAVVVFIHGYYA Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 470189 | SLC5A4 | solute carrier family 5 member 4 | 9598 | VGNC:7805 | OMA, EggNOG |
| Macaque | 717137 | SLC5A4 | solute carrier family 5 member 4 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 64452 | Slc5a4a | solute carrier family 5, member 4a | 10090 | MGI:1927848 | Inparanoid, OMA |
| Rat | 294341 | Slc5a4 | solute carrier family 5 member 4 | 10116 | RGD:1306923 | Inparanoid, OMA |
| Dog | 100685907 | SLC5A4 | solute carrier family 5 member 4 | 9615 | VGNC:46447 | Inparanoid, OMA, EggNOG |
| Horse | 100058200 | SLC5A4 | solute carrier family 5 member 4 | 9796 | VGNC:52440 | Inparanoid, OMA |
| Cow | 527441 | SLC5A4 | solute carrier family 5 member 4 | 9913 | VGNC:34907 | Inparanoid, OMA, EggNOG |
| Pig | 397376 | SLC5A4 | solute carrier family 5 member 4 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100028976 | LOC100028976 | low affinity sodium-glucose cotransporter-like | 13616 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / transporter / carbohydrate transporter / Solute carrier family 5 member 4
protein / transporter / cation transporter / Solute carrier family 5 member 4
protein / transporter / carbohydrate transporter / Solute carrier family 5 member 4
protein / transporter / cation transporter / Solute carrier family 5 member 4
DTO Classes
protein / Transporter / SLC superfamily of solute carriers / SLC5 family of sodium-dependent glucose transporters / Hexose transporter family / Solute carrier family 5 member 4
protein / Transporter / SLC superfamily of solute carriers / SLC5 family of sodium-dependent glucose transporters / Hexose transporter family / Solute carrier family 5 member 4
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.