🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

UCP3

DescriptionMitochondrial uncoupling protein 3

Gene and Protein Information

Gene ID7352
Uniprot Accession IDs P55916 O60475 Q96HL3 UCP 3
Ensembl ID ENSP00000323740
Symbole SLC25A9 SLC25A9
FamilyBelongs to the mitochondrial carrier (TC 2.A.29) family.
Sequence
MVGLKPSDVPPTMAVKFLGAGTAACFADLVTFPLDTAKVRLQIQGENQAVQTARLVQYRGVLGTILTMVRTEGPCSPYNGLVAGLQRQMSFASIRIGLYDSVKQVYTPKGADNSSLTTRILAGCTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWKGTLPNIMRNAIVNCAEVVTYDILKEKLLDYHLLTDNFPCHFVSAFGAGFCATVVASPVDVVKTRYMNSPPGQYFSPLDCMIKMVAQEGPTAFYKGFTPSFLRLGSWNVVMFVTYEQLKRALMKVQMLRESPF
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp748551UCP3uncoupling protein 39598VGNC:10234OMA, EggNOG
Mouse22229Ucp3uncoupling protein 3 (mitochondrial, proton carrier)10090MGI:1099787Inparanoid, OMA, EggNOG
Rat25708Ucp3uncoupling protein 310116RGD:3933Inparanoid, OMA, EggNOG
Dog403575UCP3uncoupling protein 39615Inparanoid, OMA
Horse100052085UCP3uncoupling protein 39796VGNC:24768Inparanoid, OMA, EggNOG
Cow281563UCP3uncoupling protein 39913VGNC:36642Inparanoid, OMA, EggNOG
Pig397116UCP3uncoupling protein 39823Inparanoid, OMA, EggNOG
Opossum619390UCP3mitochondrial uncoupling protein 313616Inparanoid, OMA, EggNOG
Platypus100090617LOC100090617mitochondrial uncoupling protein 39258OMA, EggNOG
Chicken373896UCP3uncoupling protein 39031CGNC:48948Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Transporter    /    SLC superfamily of solute carriers    /    SLC25 family of mitochondrial transporters    /    Mitochondrial uncoupling proteins    /    Mitochondrial uncoupling protein 3

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.