Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Tumor-associated calcium signal transducer 2 |
|---|
Gene and Protein Information
| Gene ID | 4070 |
|---|---|
| Uniprot Accession IDs | P09758 Q15658 Q6FG48 Q7Z7Q4 Q96QD2 |
| Ensembl ID | ENSP00000360269 |
| Symbole | GA733-1 M1S1 TROP2 EGP1 GP50 M1S1 EGP-1 TROP2 GA7331 GA733-1 |
| Family | Belongs to the EPCAM family. |
| Sequence | MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 456890 | TACSTD2 | tumor associated calcium signal transducer 2 | 9598 | OMA, EggNOG | |
| Macaque | 716334 | TACSTD2 | tumor associated calcium signal transducer 2 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 56753 | Tacstd2 | tumor-associated calcium signal transducer 2 | 10090 | MGI:1861606 | Inparanoid, OMA, EggNOG |
| Rat | 494343 | Tacstd2 | tumor-associated calcium signal transducer 2 | 10116 | RGD:1359498 | Inparanoid, OMA, EggNOG |
| Cow | 539853 | TACSTD2 | tumor associated calcium signal transducer 2 | 9913 | VGNC:35563 | Inparanoid, OMA, EggNOG |
| Pig | 100510966 | TACSTD2 | tumor associated calcium signal transducer 2 | 9823 | OMA, EggNOG | |
| Opossum | 100032064 | TACSTD2 | tumor associated calcium signal transducer 2 | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | TACSTD2 | tumor associated calcium signal transducer 2 [Source:HGNC Symbol;Acc:HGNC:11530] | 28377 | Inparanoid, OMA, EggNOG | ||
| Xenopus | 496567 | epcam | epithelial cell adhesion molecule | 8364 | XB-GENE-986667 | OMA, EggNOG |
| Zebrafish | 406454 | epcam | epithelial cell adhesion molecule | 7955 | ZDB-GENE-040426-2209 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.