EYA2

DescriptionEyes absent homolog 2

Gene and Protein Information

Gene ID2139
Uniprot Accession IDs O00167 Q5JSW8 Q86U84 Q96CV6 Q96H97 Q99503 Q99812 Q9BWF6 Q9H4S3 Q9H4S9 Q9NPZ4 Q9UIX7
Ensembl ID ENSP00000333640
Symbole EAB1 EAB1
FamilyBelongs to the HAD-like hydrolase superfamily. EYA family.
Sequence
MVELVISPSLTVNSDCLDKLKFNRADAAVWTLSDRQGITKSAPLRVSQLFSRSCPRVLPRQPSTAMAAYGQTQYSAGIQQATPYTAYPPPAQAYGIPSYSIKTEDSLNHSPGQSGFLSYGSSFSTSPTGQSPYTYQMHGTTGFYQGGNGLGNAAGFGSVHQDYPSYPGFPQSQYPQYYGSSYNPPYVPASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLDETIIIFHSLLTGTFASRYGKDTTTSVRIGLMMEEMIFNLADTHLFFNDLEDCDQIHVDDVSSDDNGQDLSTYNFSADGFHSSAPGANLCLGSGVHGGVDWMRKLAFRYRRVKEMYNTYKNNVGGLIGTPKRETWLQLRAELEALTDLWLTHSLKALNLINSRPNCVNVLVTTTQLIPALAKVLLYGLGSVFPIENIYSATKTGKESCFERIMQRFGRKAVYVVIGDGVEEEQGAKKHNMPFWRISCHADLEALRHALELEYL
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp458305EYA2EYA transcriptional coactivator and phosphatase 29598VGNC:9856OMA, EggNOG
Macaque716182EYA2EYA transcriptional coactivator and phosphatase 29544Inparanoid, OMA, EggNOG
Mouse14049Eya2EYA transcriptional coactivator and phosphatase 210090MGI:109341Inparanoid, OMA, EggNOG
Rat156826Eya2EYA transcriptional coactivator and phosphatase 210116RGD:620096Inparanoid, OMA, EggNOG
Dog609926EYA2EYA transcriptional coactivator and phosphatase 29615VGNC:40537Inparanoid, OMA, EggNOG
Horse100071250EYA2EYA transcriptional coactivator and phosphatase 29796VGNC:17746Inparanoid, OMA, EggNOG
Cow615264EYA2EYA transcriptional coactivator and phosphatase 29913VGNC:28671Inparanoid, OMA, EggNOG
Pig100624872EYA2EYA transcriptional coactivator and phosphatase 29823OMA, EggNOG
Opossum100023574EYA2EYA transcriptional coactivator and phosphatase 213616Inparanoid, EggNOG
Platypus100074653EYA2EYA transcriptional coactivator and phosphatase 29258Inparanoid, OMA, EggNOG
Chicken107054875EYA2EYA transcriptional coactivator and phosphatase 29031CGNC:77843Inparanoid, OMA, EggNOG
Anole lizard100558675eya2EYA transcriptional coactivator and phosphatase 228377Inparanoid, OMA, EggNOG
Xenopus100037919eya2EYA transcriptional coactivator and phosphatase 28364XB-GENE-487844Inparanoid, OMA, EggNOG
Zebrafish447819eya2EYA transcriptional coactivator and phosphatase 27955ZDB-GENE-040912-24OMA, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.