224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Eyes absent homolog 2 |
|---|
Gene and Protein Information
| Gene ID | 2139 |
|---|---|
| Uniprot Accession IDs | O00167 Q5JSW8 Q86U84 Q96CV6 Q96H97 Q99503 Q99812 Q9BWF6 Q9H4S3 Q9H4S9 Q9NPZ4 Q9UIX7 |
| Ensembl ID | ENSP00000333640 |
| Symbole | EAB1 EAB1 |
| Family | Belongs to the HAD-like hydrolase superfamily. EYA family. |
| Sequence | MVELVISPSLTVNSDCLDKLKFNRADAAVWTLSDRQGITKSAPLRVSQLFSRSCPRVLPRQPSTAMAAYGQTQYSAGIQQATPYTAYPPPAQAYGIPSYSIKTEDSLNHSPGQSGFLSYGSSFSTSPTGQSPYTYQMHGTTGFYQGGNGLGNAAGFGSVHQDYPSYPGFPQSQYPQYYGSSYNPPYVPASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLDETIIIFHSLLTGTFASRYGKDTTTSVRIGLMMEEMIFNLADTHLFFNDLEDCDQIHVDDVSSDDNGQDLSTYNFSADGFHSSAPGANLCLGSGVHGGVDWMRKLAFRYRRVKEMYNTYKNNVGGLIGTPKRETWLQLRAELEALTDLWLTHSLKALNLINSRPNCVNVLVTTTQLIPALAKVLLYGLGSVFPIENIYSATKTGKESCFERIMQRFGRKAVYVVIGDGVEEEQGAKKHNMPFWRISCHADLEALRHALELEYL Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 458305 | EYA2 | EYA transcriptional coactivator and phosphatase 2 | 9598 | VGNC:9856 | OMA, EggNOG |
| Macaque | 716182 | EYA2 | EYA transcriptional coactivator and phosphatase 2 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 14049 | Eya2 | EYA transcriptional coactivator and phosphatase 2 | 10090 | MGI:109341 | Inparanoid, OMA, EggNOG |
| Rat | 156826 | Eya2 | EYA transcriptional coactivator and phosphatase 2 | 10116 | RGD:620096 | Inparanoid, OMA, EggNOG |
| Dog | 609926 | EYA2 | EYA transcriptional coactivator and phosphatase 2 | 9615 | VGNC:40537 | Inparanoid, OMA, EggNOG |
| Horse | 100071250 | EYA2 | EYA transcriptional coactivator and phosphatase 2 | 9796 | VGNC:17746 | Inparanoid, OMA, EggNOG |
| Cow | 615264 | EYA2 | EYA transcriptional coactivator and phosphatase 2 | 9913 | VGNC:28671 | Inparanoid, OMA, EggNOG |
| Pig | 100624872 | EYA2 | EYA transcriptional coactivator and phosphatase 2 | 9823 | OMA, EggNOG | |
| Opossum | 100023574 | EYA2 | EYA transcriptional coactivator and phosphatase 2 | 13616 | Inparanoid, EggNOG | |
| Platypus | 100074653 | EYA2 | EYA transcriptional coactivator and phosphatase 2 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 107054875 | EYA2 | EYA transcriptional coactivator and phosphatase 2 | 9031 | CGNC:77843 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100558675 | eya2 | EYA transcriptional coactivator and phosphatase 2 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100037919 | eya2 | EYA transcriptional coactivator and phosphatase 2 | 8364 | XB-GENE-487844 | Inparanoid, OMA, EggNOG |
| Zebrafish | 447819 | eya2 | EYA transcriptional coactivator and phosphatase 2 | 7955 | ZDB-GENE-040912-24 | OMA, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.