🌎 Livrer à: United States
Basculer la navigation
Panier
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

PNMT

DescriptionPhenylethanolamine N-methyltransferase

Gene and Protein Information

Gene ID5409
Uniprot Accession IDs P11086 PNMTase
Ensembl ID ENSP00000269582
Symbole PENT PENT PNMTase
FamilyBelongs to the class I-like SAM-binding methyltransferase superfamily. NNMT/PNMT/TEMT family.
Sequence
MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp454634PNMTphenylethanolamine N-methyltransferase9598VGNC:9531OMA, EggNOG
Mouse18948Pnmtphenylethanolamine-N-methyltransferase10090MGI:97724Inparanoid, OMA, EggNOG
Rat24661Pnmtphenylethanolamine-N-methyltransferase10116RGD:3361Inparanoid, OMA, EggNOG
Dog491023PNMTphenylethanolamine N-methyltransferase9615VGNC:49943Inparanoid, OMA, EggNOG
Horse100033859PNMTphenylethanolamine N-methyltransferase9796VGNC:21629Inparanoid, OMA, EggNOG
Cow281413PNMTphenylethanolamine N-methyltransferase9913VGNC:33086Inparanoid, OMA, EggNOG
Pig100144479PNMTphenylethanolamine N-methyltransferase9823Inparanoid, OMA, EggNOG
Opossum100017260PNMTphenylethanolamine N-methyltransferase13616Inparanoid, OMA, EggNOG
PlatypusPNMTphenylethanolamine N-methyltransferase [Source:HGNC Symbol;Acc:HGNC:9160]9258OMA, EggNOG
Anole lizard100565710pnmtphenylethanolamine N-methyltransferase28377Inparanoid, OMA, EggNOG
Xenopuspnmtphenylethanolamine N-methyltransferase [Source:Xenbase;Acc:XB-GENE-962104]8364OMA, EggNOG
C. elegans175868anmt-2Amine N-MethylTransferase6239Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    transferase    /    methyltransferase    /    Phenylethanolamine N-methyltransferase
DTO Classes
protein    /    Enzyme    /    Transferase    /    Methyltransferase    /    Phenylethanolamine N-methyltransferase

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Nous utilisons des cookies pour garantir le bon fonctionnement du site et, lorsque cela est autorisé, pour améliorer votre expérience. Vous pouvez gérer vos préférences à tout moment dans les Paramètres. Pour en savoir plus, consultez notre Politique relative aux cookies.

      Souhaitez-vous que nous vous envoyions un message lorsque des réductions seront disponibles?

      Me rappeler plus tard

      Merci ! Veuillez vérifier votre boîte de réception e-mail pour confirmer.

      Oups ! Les notifications sont désactivées.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.