Recombinant Human FGF basic/FGF2 Protein

Cat. No.: rp186550
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥90%(SDS-PAGE) See COA
Accession #
P09038
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured in a cell proliferation assay using BALB/c mouse embryos cells. The ED50 for this effect is 0.21 ng/mL.
★
Size
Germany (EU)
USA*
Price
Qty
10μg
rp186550-10μg
Made to order · 8–12 wks
€79.75
50μg
rp186550-50μg
Made to order · 8–12 wks
€208.17
100μg
rp186550-100μg
Made to order · 8–12 wks
€310.56
1mg
rp186550-1mg
Made to order · 8–12 wks
€1,336.23
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,ActiBioPure™,High Performance,PBS Only,≥90%(SDS-PAGE),See COA ActiBioPure™,Bioactive,Carrier Free,High Performance,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human FGF basic/FGF2 Protein
Synonyms
basic fibroblast growth factor bFGF | Basic fibroblast growth factor | bFGF | FGF basic | FGF2 | FGF-2 | FGFBprostatropin | fibroblast growth factor 2 (basic) | HBGF-2 | heparin-binding growth factor 2 | Prostatropin
Grade
ActiBioPure™, Bioactive, Carrier Free, High Performance, PBS Only
Specifications & Purity
Carrier Free,Bioactive,ActiBioPure™,High Performance,PBS Only,≥90%(SDS-PAGE),See COA
Biochemical and Physiological Mechanisms
FGF basic (also known as FGF-2 and HBGF-2) is an 18-34 kDa, heparin-binding member of the FGF superfamily of molecules. Superfamily members are characterized by the presence of a centrally placed beta-trefoil structure. FGF acidic (FGF-1) and FGF basic (F
Bioactivity
Measured in a cell proliferation assay using BALB/c mouse embryos cells. The ED50 for this effect is 0.21 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
143-288 aa
Sequence
APALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Accession #
Predicted molecular weight
16.4 kDa
SDS-PAGE
14.9 kDa, under reducing conditions; 14.9 kDa, under non-reducing conditions
Molecule Type
Protein
Storage and Shipping
Concentration
See COA
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images

Recombinant Human FGF basic/FGF2 Protein (rp186550) - Bioactivity
Measured in a cell proliferation assay using BALB/c mouse embryos cells. The ED₅₀ for this effect is 0.21 ng/mL.

Recombinant Human FGF basic/FGF2 Protein (rp186550) - SDS-PAGE
3 μg/lane of Recombinant Human FGF basic/FGF2 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 14.9 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeDateItem
ZJ26F0232240Certificate of AnalysisFeb 28, 2026 rp186550
ZJ26F0232242Certificate of AnalysisFeb 28, 2026 rp186550
ZJ26F0232243Certificate of AnalysisFeb 28, 2026 rp186550
ZJ26F0232244Certificate of AnalysisFeb 28, 2026 rp186550
FAQs and Articles
Solution Calculators
Reviews

Customer Reviews

Frequently Asked Questions

What is the purity of this product, and how is it determined?
This product is supplied at ≥90% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.
What does Carrier Free mean?
Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
What does Bioactive mean?
Bioactive indicates that the product has been processed and tested for biological and biochemical applications. Specifications may include endotoxin limits, microbial controls, sterility, low DNase/RNase/protease activity, and verified biological activity where relevant.
How should this product be stored?
Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.
How is this product shipped?
This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.
What documentation is provided?
Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.