Determine the necessary mass, volume, or concentration for preparing a solution.
PACAP 6-38 TFA, CAS No.143748-18-9(free base)
Disponibile su ordine
GRADE & PURITY ≥95%
Toggle Nav 
Cerca
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino
Why this grade
≥95% for sensitive chromatographic and analytical workflows requiring minimal baseline interference.
Storage & shipping
Store at -20°C,Desiccated Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.
Quality documents
SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.
Literature proof
Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.
Specifications
Product Name
PACAP 6-38 TFA, CAS No.143748-18-9(free base)
Specifiche e purezza
≥95%
Meccanismi biochimici e fisiologici
Potent and competitive pituitary adenylate cyclase-activating polypeptide receptor (PAC)1antagonist (IC50= 2 nM). Inhibits PACAP(1-27)-induced stimulation of adenylate cyclase (Ki= 1.5 nM). Antitumor activityin vivo.
Sequenza
FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK(Modifications: Lys-33 = C-terminal amide)
CAS
143748-18-9(free base)
Tipo di molecola
Peptidi
Stoccaggio e spedizione
Condizioni di conservazione di stoccaggio
Store at -20°C,Desiccated
Spedito in
Ice chest + Ice pads
Documentazione
📋 Safety Data Sheet (SDS)
Comprehensive hazard, handling, storage, and regulatory compliance document.
Download SDS →✅ Certificate of Analysis (COA)
Lot-specific quality data. Enter your lot number to retrieve the exact COA.
Look up COA →🔬 Specification Sheet
Full quality attributes and acceptance criteria for this grade.
View spec sheet →Advanced Data
Certificati (CoA, COO, BSE/TSE e tabella di analisi)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Data | Oggetto |
|---|---|---|---|
 A2422434 | Certificate of Analysis | Dec 19, 2023 | P288450 |
| A2422435 | Certificate of Analysis | Dec 19, 2023 | P288450 |
| A2422436 | Certificate of Analysis | Dec 19, 2023 | P288450 |
| A2422437 | Certificate of Analysis | Dec 19, 2023 | P288450 |
| A2422438 | Certificate of Analysis | Dec 19, 2023 | P288450 |
| A2422439 | Certificate of Analysis | Dec 19, 2023 | P288450 |
| A2422440 | Certificate of Analysis | Dec 19, 2023 | P288450 |
| A2422441 | Certificate of Analysis | Dec 19, 2023 | P288450 |
| A2422442 | Certificate of Analysis | Dec 19, 2023 | P288450 |
| A2422443 | Certificate of Analysis | Dec 19, 2023 | P288450 |
Calcolatori di soluzioni
Recensioni
Recensioni dei clienti
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.