Il negozio non funziona correttamente quando i cookie sono disabilitati.
I JavaScript sembrano essere disabilitati nel tuo browser. Per una migliore esperienza sul nostro sito, assicurati di attivare i javascript nel tuo browser.
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino PACAP 6-38 TFA, CAS No.143748-18-9(free base) 🧪
Why this grade ≥95% for sensitive chromatographic and analytical workflows requiring minimal baseline interference.
🌡
Storage & shipping Store at -20°C,Desiccated Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.
📋
Quality documents SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.
📚
Literature proof Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.
Specifications Product Name
PACAP 6-38 TFA, CAS No.143748-18-9(free base)
Meccanismi biochimici e fisiologici
Potent and competitive pituitary adenylate cyclase-activating polypeptide receptor (PAC)1antagonist (IC50= 2 nM). Inhibits PACAP(1-27)-induced stimulation of adenylate cyclase (Ki= 1.5 nM). Antitumor activityin vivo.
Sequenza
FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK(Modifications: Lys-33 = C-terminal amide)
CAS
143748-18-9(free base)
Stoccaggio e spedizione Condizioni di conservazione di stoccaggio
Store at -20°C,Desiccated
Spedito in
Ice chest + Ice pads
Documentazione 📋 Safety Data Sheet (SDS) Comprehensive hazard, handling, storage, and regulatory compliance document.
Download SDS → ✅ Certificate of Analysis (COA) Lot-specific quality data. Enter your lot number to retrieve the exact COA.
Look up COA → 📊 Datasheet Quick-reference summary of product specifications and applications.
View datasheet → 🔬 Specification Sheet Full quality attributes and acceptance criteria for this grade.
View spec sheet →
Advanced Data Certificati (CoA, COO, BSE/TSE e tabella di analisi) Calcolatori di soluzioni Molarity Calculator Determine the necessary mass, volume, or concentration for preparing a solution.
Dilution Calculator Determine the dilution needed to prepare a stock solution.
Reconstitution Calculator Recensioni
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Impostazioni Accetto tutto Decline
Shall we send you a message when we have discounts available?
Remind me later Permetti
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.