Recombinant E.coli Maltose Binding Protein, >90% (SDS-PAGE)

Cat. No.: rp175915

GRADE & PURITY Carrier Free, Azide Free, His Tag, ≥90%(SDS-PAGE)

Accession #

P0AEX9

Protein Tag

N-His

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Panoramica

Purity: >90%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description：
Involved in the high-affinity maltose membrane transport system MalEFGK. Initial receptor for the active transport of and chemotaxis toward maltooligosaccharides.
Epitope tagging offers an easy and universal strategy for the identification and purification of proteins derived by recombinant DNA technology. The insertion of a Maltose Binding Protein (MBP) tag creates a stable fusion product that does not interfere with the bioactivity of the protein or with the biodistribution of the MBP tagged product.

Specifications

Product Name

Recombinant E.coli Maltose Binding Protein, >90% (SDS-PAGE)

Sinonimi

Mal E | MalE | Maltodextrin binding protein | Maltose ABC transporter periplasmic protein | Maltose binding periplasmic protein | MBP | MMBP | Periplasmic maltose binding protein

Grado

Azide Free, Carrier Free, His Tag

Specifiche e purezza

Carrier Free,Azide Free,His-Tag,≥90%(SDS-PAGE)

La purezza

>90% (SDS-PAGE)

Concentrazione di endotossina

<1.0 EU/μg

Sistema di espressione

E. coli

Aminoacidi

27-392 aa

Sequenza

MGSSHHHHHHGSSMKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSNNNNNNNNNNLGIEENLYFQ

Tag proteico

N-His

Numero d'ordine

P0AEX9

Peso molecolare previsto

44.5 kDa

SDS-PAGE

44.7 kDa, reducing conditions; 44.7 kDa, non-reducing condition

Tipo di molecola

Proteine

Stoccaggio e spedizione

Forma

Lyophilized

Ricostituzione

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Condizioni di conservazione di stoccaggio

Store at -20°C,Avoid repeated freezing and thawing

Spedito in

Ice chest + Ice pads

Stabilità e conservazione

Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle.

Immagini

SDS-PAGE: Recombinant Maltose-binding Protein (rp175915)

Recombinant Maltose-binding Protein (rp175915) - SDS-PAGE
Recombinant Maltose-binding Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 44.7 kDa.

Domande frequenti

What is the purity of this product, and how is it determined?

This product is supplied at ≥90% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.

What does Azide Free mean?

Azide Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

What does Carrier Free mean?

Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

How should this product be stored?

Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.

How is this product shipped?

This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.

What documentation is provided?

Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.