Recombinant Human ABL1 Protein

Cat. No.: rp217149

GRADE & PURITY Carrier Free, ≥95%(SDS-PAGE), expressed in E. coli; See COA

Accession #

P00519

Protein Tag

No tag

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Testing in progress

Specifications

Product Name

Recombinant Human ABL1 Protein

Sinonimi

Abelson murine leukemia viral oncogene homolog 1 | ABL | ABL1 | bcr/abl | BCR-ABL1 | c-abl oncogene 1, non-receptor tyrosine kinase | c-abl oncogene 1, receptor tyrosine kinase | cAbl | c-Abl | EC 2.7.10 | EC 2.7.10.2 | JTK7 | JTK7bcr/abl | p150bcr/c-abl

Grado

Carrier Free

Specifiche e purezza

Carrier Free,≥95%(SDS-PAGE),expressed in E. coli; See COA

Meccanismi biochimici e fisiologici

Tyrosine protein kinase ABL1 (Abelson murine leukemia viral oncogene homolog 1) is a ubiquitously expressed, magnesium-dependent, cytosolic member of the ABL subfamily of non-receptor protein tyrosine kinases. Human nonreceptor tyrosine kinases share a co

Bioattività

Testing in progress

Concentrazione di endotossina

<1.0 EU/μg

Aminoacidi

801-900 aa

Sequenza

IMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGSALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPP

Numero d'ordine

P00519

Peso molecolare previsto

10.1 kDa

SDS-PAGE

15.4 kDa, under reducing conditions; 15.4 kDa, under non-reducing conditions.

Tipo di molecola

Proteine

Product Line

Prodotti biologici

Stoccaggio e spedizione

Concentrazione

expressed in E. coli; See COA

Ricostituzione

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Condizioni di conservazione di stoccaggio

Store at -20°C,Avoid repeated freezing and thawing

Spedito in

Ice chest + Ice pads

Stabilità e conservazione

Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.

Immagini

SDS-PAGE: Recombinant Human ABL1 Protein (rp217149)

Recombinant Human ABL1 Protein (rp217149) - SDS-PAGE 

2 μg/lane of Recombinant Human ABL1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 15.4 kDa.

Domande frequenti

What is the purity of this product, and how is it determined?

This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.

What does Carrier Free mean?

Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

How should this product be stored?

Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.

How is this product shipped?

This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.

What documentation is provided?

Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.