Recombinant Human BTLA Protein, ≥95% (SDS-PAGE)

Cat. No.: rp143904
Disponibile su ordine
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. Fc tag ? Fc tag grade — recombinant protein bearing a Fc tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. The Fc tag aids dimerization and protein-A/G capture. ≥95%(SDS-PAGE)
Accession #
Q7Z6A9-2
Protein Tag
C-hFc & His
Expression system
HEK293
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Immobilized Recombinant human BTLA at 3 μg/mL (100 μL/well) can bind Biotinylated Recombinant human HVEM with a linear range of 18-72 ng/mL.
★
Size
Germania (EU)
USA*
Price
Qty
10μg
rp143904-10μg
—
Disponibile ≥10
83,22€
50μg
rp143904-50μg
—
8 Disponibile
360,89€
100μg
rp143904-100μg
—
3 Disponibile
577,83€
1mg
rp143904-1mg
Su ordinazione · 8–12 settimane
2.967,58€
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,His-Tag,Fc tag,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,Fc tag,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Panoramica

Purity
≥95% SDS-PAGE.
Endotoxin level
<0.1 EU/µg
Function
Lymphocyte inhibitory receptor which inhibits lymphocytes during immune response.

Specifications

Product Name
Recombinant Human BTLA Protein, ≥95% (SDS-PAGE)
Sinonimi
B and T lymphocyte associated | B and T lymphocyte attenuator | B- and T-lymphocyte attenuator | B- and T-lymphocyte-associated protein | BTLA | BTLA1 | CD272 antigen | CD272 | FLJ16065 | MGC129743
Grado
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, Fc tag, His Tag
Specifiche e purezza
Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,His-Tag,Fc tag,≥95%(SDS-PAGE)
La purezza
≥95% (SDS-PAGE)
Bioattività
Immobilized Recombinant human BTLA at 3 μg/mL (100 μL/well) can bind Biotinylated Recombinant human HVEM with a linear range of 18-72 ng/mL.
Concentrazione di endotossina
<0.1 EU/μg
Sistema di espressione
HEK293
Specie
Human
Aminoacidi
31-134 aa
Sequenza
KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTENLYFQGMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Tag proteico
C-Fc & His
Numero d'ordine
Peso molecolare previsto
39 kDa
SDS-PAGE
50-60 kDa, under reducing conditions
Tipo di molecola
Proteine
Stoccaggio e spedizione
Forma
Lyophilized
Ricostituzione
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Condizioni di conservazione di stoccaggio
Store at -20°C,Avoid repeated freezing and thawing
Spedito in
Ice chest + Ice pads
Stabilità e conservazione
Store at -20~-80℃ for more than 1 year.Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Immagini

Recombinant Human BTLA Protein (rp143904) - Protein Bioactivity
Immobilized Recombinant Human BTLA Protein (rp143904) at 3.0 μg/mL can bind Biotinylated Recombinant Human HVEM with a linear range of 18 - 75 ng/mL.

Recombinant Human BTLA Protein (rp143904) - SDS-PAGE
3 μg/lane of Recombinant Human BTLA Protein was resolved with SDS-PAGE under reducing (R) condition and visualized by Coomassie® Blue staining, showing a band at 50.0 - 60.0 kDa under reducing condition.

Documentazione

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificati (CoA, COO, BSE/TSE e tabella di analisi)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDataOggetto
ZJ24F0404866Certificate of AnalysisSep 10, 2026 rp143904
ZJ24F0404867Certificate of AnalysisSep 10, 2026 rp143904
ZJ24F0404868Certificate of AnalysisSep 10, 2026 rp143904
Domande frequenti e articoli
Calcolatori di soluzioni
Recensioni

Recensioni dei clienti

Domande frequenti

What is the purity of this product, and how is it determined?
This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.
What does Animal Free mean?
Animal Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
What does Carrier Free mean?
Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
How should this product be stored?
Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.
How is this product shipped?
This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.
What documentation is provided?
Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.