Recombinant Human BTN3A2 Protein

Cat. No.: rp143422
Disponibile su ordine
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Accession #
P78410
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Measured by its ability to enhance anti-CD3-induced IFN-gamma secretion of mouse CD3+ T cells. The ED50 for this effect is 0.5-2.5 μg/mL.
★
Size
Germania (EU)
USA*
Price
Qty
10μg
rp143422-10μg
—
Disponibile ≥10
197,76€
50μg
rp143422-50μg
—
7 Disponibile
399,07€
100μg
rp143422-100μg
—
1 Disponibile
638,57€
1mg
rp143422-1mg
Su ordinazione · 8–12 settimane
3.158,48€
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His-Tag,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Panoramica

Function
Plays a role in T-cell responses in the adaptive immune response. Inhibits the release of IFNG from activated T-cells.

Specifications

Product Name
Recombinant Human BTN3A2 Protein
Sinonimi
BT3.3 | BTF3 | BTF4 | BTF4butyrophilin protein | BTN3A2 | butyrophilin subfamily 3 member A2 | butyrophilin, subfamily 3, member A2 | FLJ40011 | BT3.2 | CD277 | BTN3.2
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, His Tag
Specifiche e purezza
Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His-Tag,≥95%(SDS-PAGE)
Bioattività
Measured by its ability to enhance anti-CD3-induced IFN-gamma secretion of mouse CD3+ T cells. The ED50 for this effect is 0.5-2.5 μg/mL.
Concentrazione di endotossina
<0.1 EU/μg
Sistema di espressione
HEK293
Specie
Human
Aminoacidi
30-248 aa
Sequenza
QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPWHHHHHH
Tag proteico
C-His
Numero d'ordine
Peso molecolare previsto
26 kDa
SDS-PAGE
27 - 32 kDa, under reducing conditions; 25 - 30 kDa, under non-reducing conditions.
Tipo di molecola
Proteine
Stoccaggio e spedizione
Forma
Lyophilized
Ricostituzione
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Condizioni di conservazione di stoccaggio
Store at -20°C,Avoid repeated freezing and thawing
Spedito in
Ice chest + Ice pads
Stabilità e conservazione
Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Immagini

Recombinant Human BTN3A2 Protein (rp143422) - SDS-PAGE
3 μg/lane of Recombinant Human BTN3A2 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 27 - 32 kDa under reducing condition and 25 - 30 kDa under non-reducing condition.

Documentazione

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificati (CoA, COO, BSE/TSE e tabella di analisi)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDataOggetto
ZJ24F1214934Certificate of AnalysisJul 13, 2026 rp143422
ZJ24F1214935Certificate of AnalysisJul 13, 2026 rp143422
ZJ24F1214936Certificate of AnalysisJul 13, 2026 rp143422
Calcolatori di soluzioni
Recensioni

Recensioni dei clienti

Domande frequenti

What is the purity of this product, and how is it determined?
This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.
What does Animal Free mean?
Animal Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
What does Carrier Free mean?
Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
How should this product be stored?
Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.
How is this product shipped?
This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.
What documentation is provided?
Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.