Recombinant Human CCL18 Protein, ＞96%(SDS-PAGE,HPLC)

Cat. No.: rp143731

GRADE & PURITY Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, PBS Only, ≥96%(SDS-PAGE&HPLC)

Accession #

P55774

Protein Tag

No tag

Expression system

E. coli

Endotoxin Concentration

<0.1 EU/μg

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration of 1.0-10 ng/ml.

Panoramica

Human CCL18 is encoded by the CCL18 gene located on the chromosome 17. As also named MIP-4, it shares 61 % sequence identity to human MIP-1α. CCL18 is mainly expressed by lung and some lymphoid tissues like lymph nodes express CCL18 at low level. It is chemotactic for both activated (CD3+) T cells and nonactivated (CD14-) lymphocytes, but not for monocytes or granulocytes. Involved in B-cell migration into B-cell follicles in lymph nodes. CCL18 plays a role in both humoral and cell mediated immunity responses. Recombinant Human MIP-4/CCL18 is a 7.9kDa protein containing 69 amino acid residues, including the four highly conserved cysteine residues present in CC chemokines.

Purity

>96% SDS-PAGE

Function

Chemotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved in B-cell migration into B-cell follicles in lymph nodes. Attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph nodes, has chemotactic activity for naive T-cells, CD4+ and CD8+ T-cells and thus may play a role in both humoral and cell-mediated immunity responses.

Specifications

Product Name

Recombinant Human CCL18 Protein, ＞96%(SDS-PAGE,HPLC)

Sinonimi

Human Macrophage Inflammatory Protein-4, Alternative macrophage activation-associated CC chemokine 1 | AMAC-1 | AMAC1 | CC chemokine ligand 18 | AMAC-1Small-inducible cytokine A18 | CCL18 | chemokine (C-C motif) ligand 18 (pulmonary and activation-regulat

Grado

ActiBioPure™, Azide Free, Bioactive, Carrier Free, High Performance, PBS Only

Specifiche e purezza

Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,PBS Only,≥96%(SDS-PAGE&HPLC)

La purezza

＞96%(SDS-PAGE,HPLC)

Bioattività

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration of 1.0-10 ng/ml.

Concentrazione di endotossina

<0.1 EU/μg

Sistema di espressione

E.coli

Specie

Human

Aminoacidi

22-89aa

Sequenza

QVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICA DPNKKWVQKYISDLKLNA

Tag proteico

No tag

Numero d'ordine

P55774

Peso molecolare previsto

7.9kDa

SDS-PAGE

9.5 kDa, under reducing conditions; 12.0 kDa, under non-reducing conditions.

Tipo di molecola

Proteine

Stoccaggio e spedizione

Forma

Lyophilized

Ricostituzione

1、 This vial must be briefly centrifuged prior to opening to bring the contents to the bottom。 2、 Reconstitute in a sterile aqueous buffer to an appropriate concentration。

Condizioni di conservazione di stoccaggio

Store at -80°C,Avoid repeated freezing and thawing

Spedito in

Dry ice packs + Cold packs

Stabilità e conservazione

Shipped at 4°C. Lyophilized from a 0.2 µm filtered solution in PBS, pH 7.0. Store at -80°C. Avoid freeze / thaw cycle

Immagini

Protein Bioactivity: Recombinant Human CCL18 Protein (rp143731)

Recombinant Human CCL18 Protein (rp143731) - Protein Bioactivity
The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration of 1.0-10 ng/mL.

SDS-PAGE: Recombinant Human CCL18 Protein (rp143731)

Recombinant Human CCL18 Protein (rp143731) - SDS-PAGE
2.5μg/lane of Recombinant Human CCL18 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 9.5 kDa under reducing conditions and 12.0 kDa under non-reducing conditions.

Domande frequenti

What does Carrier Free mean?

Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

What does Bioactive mean?

Bioactive indicates that the product has been processed and tested for biological and biochemical applications. Specifications may include endotoxin limits, microbial controls, sterility, low DNase/RNase/protease activity, and verified biological activity where relevant.

How should this product be stored?

Store at ?80 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.

How is this product shipped?

This product ships frozen with dry ice and cold packs. Unpack on arrival and transfer it to the storage condition stated above; handle dry ice with insulated gloves in a ventilated area.

What documentation is provided?

Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.