Recombinant Human CEACAM7 Protein

Cat. No.: rp188227
Disponibile su ordine
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE) See COA
Accession #
Q14002
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human CEACAM7 Protein (rp188227) at 2.0 μg/mL can bind Recombinant Human CEACAM-1/CD66a Protein (rp144247) with the EC50 of 12.6 ng/mL.
Size
Germania (EU)
USA*
Price
Qty
10μg
rp188227-10μg
3 Disponibile
121,40€
50μg
rp188227-50μg
3 Disponibile
347,01€
100μg
rp188227-100μg
3 Disponibile
520,56€
1mg
rp188227-1mg
Su ordinazione · 8–12 settimane
4.251,83€
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,His Tag,PBS Only,≥95%(SDS-PAGE),See COA ActiBioPure™,Animal Free,Bioactive,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human CEACAM7 Protein
Sinonimi
Carcinoembryonic antigen CGM 2 | Carcinoembryonic antigen CGM2 | Carcinoembryonic antigen gene family member 2 | Carcinoembryonic antigen related cell adhesion molecule 7 | CEA | CEACAM 7 | CEACAM7 | CEACAM-7 | CGM 2 | CGM2
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, His Tag, PBS Only
Specifiche e purezza
Animal Free,Carrier Free,Bioactive,ActiBioPure™,His Tag,PBS Only,≥95%(SDS-PAGE),See COA
Meccanismi biochimici e fisiologici
Carcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM-7), also known as CGM2, is an approximately 40 kDa GPI-anchored glycoprotein in the CEACAM family of adhesion molecules. Mature human CEACAM-7 consists of two Ig-like domains followed by th
Bioattività
Immobilized Recombinant Human CEACAM7 Protein (rp188227) at 2.0 μg/mL can bind Recombinant Human CEACAM-1/CD66a Protein (rp144247) with the EC50 of 12.6 ng/mL.
Concentrazione di endotossina
<1.0 EU/μg
Aminoacidi
1-233 aa
Sequenza
MGSPSACPYRVCIPWQGLLLTASLLTFWNLPNSAQTNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNHHHHHH
Numero d'ordine
Peso molecolare previsto
23.3 kDa
SDS-PAGE
36.2-48.4 kDa, under reducing conditions; 34.8-47.8 kDa, under non-reducing conditions.
Tipo di molecola
Proteine
Stoccaggio e spedizione
Concentrazione
See COA
Ricostituzione
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condizioni di conservazione di stoccaggio
Store at -20°C,Avoid repeated freezing and thawing
Spedito in
Ice chest + Ice pads
Stabilità e conservazione
Store at -20℃ for 1 year. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Immagini

Recombinant Human CEACAM7 Protein (rp188227) - Binding Activity
Immobilized Recombinant Human CEACAM7 Protein (rp188227) at 2.0 μg/mL can bind Recombinant Human CEACAM-1/CD66a Protein (rp144247) with the EC50 of 12.6 ng/mL.

Recombinant Human CEACAM7 Protein (rp188227) - SDS-PAGE
3 μg/lane of Recombinant Human CEACAM7 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 36.2-48.4 kDa under reducing conditions and 34.8-47.8 kDa under non-reducing conditions.

Documentazione

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificati (CoA, COO, BSE/TSE e tabella di analisi)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDataOggetto
ZJ25F0622472Certificate of AnalysisApr 13, 2026 rp188227
ZJ25F0622473Certificate of AnalysisApr 13, 2026 rp188227
ZJ25F0622474Certificate of AnalysisApr 13, 2026 rp188227
Domande frequenti e articoli
Calcolatori di soluzioni
Recensioni

Recensioni dei clienti

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.