Recombinant Human Complement Component C3a Protein

Cat. No.: rp183573

QUALITÀ & PUREZZA Carrier Free, PBS Only, ≥95%(SDS-PAGE)

Accession #

P01024

Protein Tag

No tag

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Testing in progress

Specifiche

Product Name

Recombinant Human Complement Component C3a Protein

Sinonimi

AHUS5 | ARMD9 | ASP | C3a | C3b | Complement C3 | CPAMD1 | HEL-S-62p | Anaphylatoxin | C3 | Complement Component C3a

Grado

Carrier Free, PBS Only

Specifiche e purezza

Carrier Free,PBS Only,≥95%(SDS-PAGE)

Meccanismi biochimici e fisiologici

C3a is an anaphylotoxin polypeptide comprising amino acids (aa) 672-748 of the Complement C3 precursor protein. Anaphylatoxins are proteolytically generated from the C3, C4 and C5 alpha chains by convertases formed by other complement fragments. They shar

Bioattività

Testing in progress

Concentrazione di endotossina

<1.0 EU/μg

Aminoacidi

672-748 aa

Sequenza

SVQLTEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEACKKVFLDCCNYITELRRQHARASHLGLAR

Numero d'ordine

P01024

Peso molecolare previsto

9.1 kDa

SDS-PAGE

10.9 kDa, under reducing conditions; 11.3 kDa, under non-reducing conditions.

Tipo di molecola

Proteine

Product Line

Prodotti biologici

Stoccaggio e spedizione

Ricostituzione

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Condizioni di conservazione di stoccaggio

Store at -20°C,Avoid repeated freezing and thawing

Spedito in

Ice chest + Ice pads

Stabilità e conservazione

Store at -20°C for 1 year. Avoid freeze/thaw cycle.

Immagini

SDS-PAGE: Recombinant Human Complement Component C3a Protein (rp183573)

Recombinant Human Complement Component C3a Protein (rp183573) - SDS-PAGE
3 μg/lane of Recombinant Human Complement Component C3a Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 10.9 kDa under reducing conditions and 11.3 kDa under non-reducing conditions.

Obiettivi associati (umani)

C3 Tclin Complement C3 (0 Activities)

Discover Target: C3

Activity Type	Activity Value -log(M)	Mechanism of Action	Activity Reference	Publications (PubMed IDs)

Domande frequenti

What is the purity of this product, and how is it determined?

This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.

What does Carrier Free mean?

Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

What does PBS Only mean?

PBS Only is a defined analytical purity tier suitable for workflows requiring a specific validated property. It specifies a minimum assay percentage, controlled limits on common impurities (water, heavy metals, residue on ignition), and lot-to-lot consistency. PBS Only is one of several purity tiers — choose based on the sensitivity and regulatory requirements of your method.

How should this product be stored?

Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.

How is this product shipped?

This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.

What documentation is provided?

Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.