Recombinant Human DUSP22 Protein

Cat. No.: rp189418

GRADE & PURITY Carrier Free, His Tag, ≥90%(SDS-PAGE), expressed in E. coli; See COA

Accession #

Q9NRW4

Protein Tag

N-His

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Specifications

Product Name

Recombinant Human DUSP22 Protein

Grado

Carrier Free, His Tag

Specifiche e purezza

Carrier Free,His Tag,≥90%(SDS-PAGE),expressed in E. coli; See COA

Meccanismi biochimici e fisiologici

Dual Specificity Phosphatase 22, also known as DUSP22, is a part of the protein-tyrosine phosphatase family which holds 1 tyrosine-protein phosphatase domain. DUSP22 activates the Jnk signaling pathway and dephosphorylates and deactivates p38 and stress-a

Concentrazione di endotossina

<1.0 EU/μg

Aminoacidi

2-184 aa

Sequenza

MHHHHHHGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL

Numero d'ordine

Q9NRW4

Peso molecolare previsto

21.7 kDa

SDS-PAGE

19.7 kDa, under reducing conditions; 19.1 & 37.6 kDa, under non-reducing conditions.

Tipo di molecola

Proteine

Stoccaggio e spedizione

Concentrazione

expressed in E. coli; See COA

Condizioni di conservazione di stoccaggio

Store at -20°C,Avoid repeated freezing and thawing

Spedito in

Ice chest + Ice pads

Stabilità e conservazione

Store at -20℃ long term (12 months). Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.

Immagini

SDS-PAGE: Recombinant Human DUSP22 Protein (rp189418)

Recombinant Human DUSP22 Protein (rp189418) - SDS-PAGE 

3 μg/lane of Recombinant Human DUSP22 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the bands at 19.7 kDa under reducing conditions and 19.1 & 37.6 kDa under non-reducing conditions. DUSP22 is a dual-specificity phosphatase. The catalytic domain of DUSP22 contains a conserved cysteine (Cys) active site, which promotes protein dimer formation through disulfide bond formation (Uniprot ID: Q9NRW4).  

Domande frequenti

What is the purity of this product, and how is it determined?

This product is supplied at ≥90% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.

How should this product be stored?

Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.

What does Carrier Free mean?

Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

What is His Tag?

His Tag refers to a recombinant protein product fused with the His affinity tag, suitable for recombinant protein expression and affinity purification. The tag enables one-step affinity purification, immobilization or detection without affecting downstream activity in most cases.

How is this product shipped?

This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.

What documentation is provided?

Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.