Recombinant Human EIF2B1 Protein

Cat. No.: rp192073

GRADE & PURITY Carrier Free, His Tag, ≥90%(SDS-PAGE), expressed in E. coli; See COA

Accession #

Q14232

Protein Tag

N-His

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Specifications

Product Name

Recombinant Human EIF2B1 Protein

Sinonimi

Translation initiation factor eIF-2B subunit alpha | eIF-2B GDP-GTP exchange factor subunit alpha | EIF2B1 | EIF2BA | EIF2B

Grado

Carrier Free, His Tag

Specifiche e purezza

Carrier Free,His Tag,≥90%(SDS-PAGE),expressed in E. coli; See COA

Meccanismi biochimici e fisiologici

EIF2B1 is one of five subunits of eukaryotic translation initiation factor 2B (EIF2B), which is a GTP exchange factor for eukaryotic initiation factor 2 and an essential regulator for protein synthesis. Phosphorylation of eIF2 inhibits GEF activity of EIF

Concentrazione di endotossina

<1.0 EU/μg

Aminoacidi

2-305 aa

Sequenza

MHHHHHHDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL​

Numero d'ordine

Q14232

Peso molecolare previsto

34.5 kDa

SDS-PAGE

30.9 kDa, under reducing conditions.

Tipo di molecola

Proteine

Stoccaggio e spedizione

Concentrazione

expressed in E. coli; See COA

Condizioni di conservazione di stoccaggio

Store at -20°C,Avoid repeated freezing and thawing

Spedito in

Ice chest + Ice pads

Stabilità e conservazione

Store at -20℃ long term (12 months). Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.

Immagini

SDS-PAGE: Recombinant Human EIF2B1 Protein (rp192073)

Recombinant Human EIF2B1 Protein (rp192073) - SDS-PAGE 

3 μg/lane of Recombinant Human EIF2B1 Protein was resolved with SDS-PAGE under reducing (R) and visualized by Coomassie® Blue staining, showing a band at 30.9 kDa under reducing conditions. Within the complex, the hexameric regulatory complex resides at the center, with the two heterodimeric catalytic subcomplexes bound on opposite sides (PubMed: 25858979, PubMed: 31048492).

Domande frequenti

What is the purity of this product, and how is it determined?

This product is supplied at ≥90% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.

What is His Tag?

His Tag refers to a recombinant protein product fused with the His affinity tag, suitable for recombinant protein expression and affinity purification. The tag enables one-step affinity purification, immobilization or detection without affecting downstream activity in most cases.

What does Carrier Free mean?

Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

How should this product be stored?

Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.

How is this product shipped?

This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.

What documentation is provided?

Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.