Recombinant Human eNOS Protein

Cat. No.: rp183745

GRADE & PURITY Carrier Free, His Tag, ≥90%(SDS-PAGE)

Accession #

P29474

Protein Tag

N-His

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Panoramica

Produces nitric oxide (NO) which is implicated in vascular smooth muscle relaxation through a cGMP-mediated signal transduction pathway. NO mediates vascular endothelial growth factor (VEGF)-induced angiogenesis in coronary vessels and promotes blood clotting through the activation of platelets.
Isoform eNOS13C: Lacks eNOS activity, dominant-negative form that may down-regulate eNOS activity by forming heterodimers with isoform 1.

Specifications

Product Name

Recombinant Human eNOS Protein

Sinonimi

Constitutive NOS | EC NOS | EC-NOS | ecNOS | Endothelial nitric oxidase synthase | Endothelial nitric oxide synthase | Endothelial nitric oxide synthase 3 | Endothelial NOS | eNOS | Nitric oxide synthase 3 | Nitric oxide synthase 3 (endothelial cell) | Ni

Grado

Carrier Free, His Tag

Specifiche e purezza

Carrier Free,His-Tag,≥90%(SDS-PAGE)

Concentrazione di endotossina

<1.0 EU/μg

Sistema di espressione

E. coli

Aminoacidi

1035-1200 aa

Sequenza

MHHHHHHKGLQPTPMTLVFGCRCSQLDHLYRDEVQNAQQRGVFGRVLTAFSREPDNPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATNVLQTVQRILATEGDMELDEAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQLRGAVPWAFDPPGSDT

Tag proteico

N-His

Numero d'ordine

P29474

Peso molecolare previsto

19.7 kDa

SDS-PAGE

17.5 kDa, under reducing conditions; 16.7 kDa, under non-reducing conditions

Tipo di molecola

Proteine

Product Line

Prodotti biologici

Stoccaggio e spedizione

Ricostituzione

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Condizioni di conservazione di stoccaggio

Store at -20°C,Avoid repeated freezing and thawing

Spedito in

Ice chest + Ice pads

Stabilità e conservazione

Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Immagini

SDS-PAGE: Recombinant Human eNOS Protein (rp183745)

Recombinant Human eNOS Protein (rp183745) - SDS-PAGE
2 μg/lane of Recombinant Human eNOS Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 17.5 kDa under reducing conditions and 16.7 kDa under non-reducing conditions.

Domande frequenti

What is the purity of this product, and how is it determined?

This product is supplied at ≥90% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.

What does Carrier Free mean?

Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

What is His Tag?

His Tag refers to a recombinant protein product fused with the His affinity tag, suitable for recombinant protein expression and affinity purification. The tag enables one-step affinity purification, immobilization or detection without affecting downstream activity in most cases.

How should this product be stored?

Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.

How is this product shipped?

This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.

What documentation is provided?

Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.