Recombinant Human FGF-23 Protein

Cat. No.: rp222570
Disponibile su ordine
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE) expressed in HEK293; See COA
Accession #
Q9GZV9
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured in a cell proliferation assay using NIH‑3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 35.4 ng/mL in the presence of Recombinant Mouse Klotho beta.
Size
Germania (EU)
USA*
Price
Qty
10μg
rp222570-10μg
Su ordinazione · 8–12 settimane
121,40€
50μg
rp222570-50μg
Su ordinazione · 8–12 settimane
347,01€
100μg
rp222570-100μg
Su ordinazione · 8–12 settimane
546,59€
1mg
rp222570-1mg
Su ordinazione · 8–12 settimane
2.863,45€
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His Tag,≥95%(SDS-PAGE),expressed in HEK293; See COA ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human FGF-23 Protein
Sinonimi
Fibroblast Growth Factor 23 | FGF23 | HYPF | FGF-23 | ADHR | HPDR2 | UNQ3027/PRO9828 | Phosphatonin | Tumor-derived hypophosphatemia-inducing factor
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, His Tag
Specifiche e purezza
Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His Tag,≥95%(SDS-PAGE),expressed in HEK293; See COA
Meccanismi biochimici e fisiologici
Fibroblast growth factor 23 (FGF‑23) is a 30‑32 kDa member of the FGF family, within a subfamily that also includes FGF‑19 and FGF‑21. FGF proteins contain a 120 amino acid (aa) core FGF domain that exhibits a beta ‑trefoil structure. FGF‑19 subfamily mem
Bioattività
Measured in a cell proliferation assay using NIH‑3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 35.4 ng/mL in the presence of Recombinant Mouse Klotho beta.
Concentrazione di endotossina
<1.0 EU/μg
Aminoacidi
1-251 aa (R179Q)
Sequenza
MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFIHHHHHH
Numero d'ordine
Peso molecolare previsto
26.1 kDa
SDS-PAGE
27.2-34.0 kDa; under reducing conditions; 26.3-32.7 kDa; under non-reducing conditions.
Tipo di molecola
Proteine
Stoccaggio e spedizione
Concentrazione
expressed in HEK293; See COA
Condizioni di conservazione di stoccaggio
Store at -20°C,Avoid repeated freezing and thawing
Spedito in
Ice chest + Ice pads
Stabilità e conservazione
Store at -20℃ for 6 months. Upon receipt; it is recommended to aliquot. Avoid freeze/thaw cycle.
Immagini
Recombinant Human FGF23 Protein (rp222570) - Protein Bioactivity 
Measured in a cell proliferation assay using NIH‑3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 35.4 ng/mL in the presence of Recombinant Mouse Klotho beta.
Recombinant Human FGF23 Protein (rp222570) - SDS-PAGE 
3 μg/lane of Recombinant Human FGF23 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 27.2-34.0 kDa under reducing conditions and 26.3-32.7 kDa under non-reducing conditions.

Documentazione

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificati (CoA, COO, BSE/TSE e tabella di analisi)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Calcolatori di soluzioni
Recensioni

Recensioni dei clienti

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.