Recombinant human FGF1 protein, >95% SDS-PAGE

Cat. No.: rp145907
Disponibile su ordine
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. ≥95%(SDS-PAGE)
Accession #
P05230
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Measured in a cell proliferation assay using BALB/3T3 mouse embryo fibroblasts cell line in the presence of heparin. The ED₅₀ for this effect is typically <0.5ng/mL.
★
Size
Germania (EU)
USA*
Price
Qty
25μg
rp145907-25μg
—
Disponibile ≥10
50,24€
100μg
rp145907-100μg
—
1 Disponibile
173,46€
1mg
rp145907-1mg
Su ordinazione · 8–12 settimane
1.145,33€
Enter a quantity for the sizes you want to add.
🧪

Why this grade

ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,High Performance for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Panoramica

Purity

>95% as determined by SDS-PAGE and Coomassie blue staining

Function

The heparin-binding fibroblast growth factors play important roles in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. They are potent mitogens in vitro.

Sequence similarities

Belongs to the heparin-binding growth factors family.

Cellular localization

Secreted. Cytoplasm. Cytoplasm > cell cortex. Lacks a cleavable signal sequence. Within the cytoplasm, it is transported to the cell membrane and then secreted by a non-classical pathway that requires Cu(2+) ions and S100A13. Secreted in a complex with SYT1.


Specifications

Product Name
Recombinant human FGF1 protein, >95% SDS-PAGE
Sinonimi
Acidic fibroblast growth factor | aFGF | ECGF | Endothelial cell growth factor | FGF-1 | HBGF-1 | Heparin-binding growth factor 1
Grado
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance
Specifiche e purezza
ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE)
La purezza
>95% SDS-PAGE
Bioattività
Measured in a cell proliferation assay using BALB/3T3 mouse embryo fibroblasts cell line in the presence of heparin. The ED₅₀ for this effect is typically <0.5ng/mL.
Concentrazione di endotossina
<0.1 EU/μg
Sistema di espressione
E. coli
Specie
Human
Aminoacidi
16-155 aa
Sequenza
FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAES VGEVYIKSTE TGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVG LKKNGSCKRG PRTHYGQKAILFLPLPVSSD
Tag proteico
No tag
Lunghezza delle proteine
Full length protein
Numero d'ordine
Fonte
Recombinant
Peso molecolare previsto
15.9 kDa
Tipo di molecola
Proteine
Stoccaggio e spedizione
Forma
Lyophilized
Ricostituzione
After receiving lyophilized powder protein, centrifuge first, and then r econstitute at 100µg/mL in sterile PBS.
Condizioni di conservazione di stoccaggio
Store at -20°C
Spedito in
Ice chest + Ice pads
Stabilità e conservazione
Stable for 12 months from the date of receipt of the product under proper storage andhandling conditions. Avoid repeated freeze-thaw cycles.
Immagini

Recombinant Human FGF1 Protein (rp145907)-Protein Bioactivity
Measured in a cell proliferation assay using BALB/3T3 mouse embryo fibroblasts cell line in the presence of heparin. The ED50 for this effect is typically <0.5ng/mL.

Recombinant Human FGF1 Protein (rp145907)-SDS-PAGE
3μg/lane of Recombinant Human FGF1 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a single band at 13.3 kDa.

Documentazione

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificati (CoA, COO, BSE/TSE e tabella di analisi)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeDataOggetto
ZJ23F0400116Certificate of AnalysisMay 19, 2026 rp145907
ZJ23F0400117Certificate of AnalysisMay 19, 2026 rp145907
ZJ23F1101722Certificate of AnalysisApr 09, 2026 rp145907
ZJ23F1101723Certificate of AnalysisApr 09, 2026 rp145907
Domande frequenti e articoli
Calcolatori di soluzioni
Recensioni

Recensioni dei clienti

Domande frequenti

What is the purity of this product, and how is it determined?
This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.
What does Animal Free mean?
Animal Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
How should this product be stored?
Store at ?20 °C. Freezer storage is required to maintain the specified shelf life.
What does Carrier Free mean?
Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
How is this product shipped?
This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.
What documentation is provided?
Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.