Recombinant Human IL-32 alpha Protein, ≥95% (SDS-PAGE)
Disponibile
SKU
rp147557
Animal Free, ≥95% (SDS-PAGE), Active, E.coli, No tag, 2-131 aa
Purity
≥95% SDS-PAGE.
Endotoxin level
<1.0 EU/µg
Function
Cytokine that may play a role in innate and adaptive immune responses. It induces various cytokines such as TNFA/TNF-alpha and IL8. It activates typical cytokine signal pathways of NF-kappa-B and p38 MAPK.
Maggiori Informazioni
| Sinonimi | IL32 gamma; IL-32 gamma; IL32; IL-32alpha; IL-32beta; IL-32delta; IL-32gamma; interleukin 32; NK4; TAIF; TAIFa; TAIFb; TAIFc; TAIFd |
|---|---|
| Product Description | Purity |
| Specifiche e purezza | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) |
| La purezza | ≥95% (SDS-PAGE) |
| Bioattività | Measured by its ability to induce TNF-alpha secretion by RAW 264.7 mouse monocyte/macrophage cellsunder serum free conditions in the presence of muramyl dipeptide (MDP). The ED50 for this effect is less than 12 μg/mL. |
| Concentrazione di endotossina | <1.0 EU/μg |
| Sistema di espressione | E. coli |
| Specie | Human |
| Aminoacidi | 2-131 aa |
| Sequenza | MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKSYGAPRGDKEELTPQKCSEPQSSK |
| Tag proteico | No tag |
| Numero d'ordine | AAS80146 |
| SDS-PAGE | 19 kDa under reducing conditions. |
| Forma | Lyophilized |
| Ricostituzione | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
| Condizioni di conservazione di stoccaggio | Store at -20°C,Avoid repeated freezing and thawing |
| Spedito in | Ice chest + Ice pads |
| Stabilità e conservazione | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
| Gene Id | 9235 |
| Simbolo genico | IL32 |
Recensioni
Recensioni dei clienti
Remind me later