Proteina MMP-2 umana ricombinante

Cat. No.: rp181213
Disponibile su ordine
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥90%(SDS-PAGE)
Accession #
P08253
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human MMP-2 Protein (rp181213) at 1.0 μg/mL can bind MMP2 Mouse mAb (Ab115657) with the EC50 of 23.04 ng/mL
Size
Germania (EU)
USA*
Price
Qty
10μg
rp181213-10μg
Disponibile ≥10
190,82€
50μg
rp181213-50μg
8 Disponibile
589,98€
100μg
rp181213-100μg
8 Disponibile
867,65€
1mg
rp181213-1mg
1 Disponibile
3.731,19€
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Senza animali, senza vettore, bioattivo, ≥90% (SDS-PAGE) Animal Free,Bioactive,Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Conservare a -20°C, evitando di congelare e scongelare ripetutamente Ships Cassetta del ghiaccio + cuscini per il ghiaccio Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Panoramica

Purezza: ≥90%, mediante SDS-PAGE visualizzato con colorazione blu Coomassie®.
Descrizione: MMP-2
La metalloproteinasi-2 della matrice (MMP-2) è un enzima che degrada i componenti della matrice extracellulare e svolge quindi un ruolo fondamentale nella migrazione cellulare durante i processi fisiologici e patologici. L'espressione della MMP-2 dipende dall'induttore della metalloproteinasi della matrice extracellulare (EMMPRIN), da Her2/neu, da fattori di crescita, citochine e ormoni. L'attivazione della Pro-MMP-2 richiede il contributo di MT1-MMP e TIMP-2. La MMP-2 è modificata nella distribuzione e aumentata in quantità nel nucleo cocleare ventrale dopo l'ablazione cocleare unilaterale. Un basso livello di MMP-2 è legato a una prognosi favorevole nei pazienti con un tumore negativo per i recettori ormonali, solitamente associato a un rischio elevato. Essendo uno zimogeno che richiede un'attivazione proteolitica per l'attività catalitica, la MMP-2 è stata ampiamente implicata nell'invasione e nella metastasi di molti sistemi modello di cancro, compreso il cancro al seno umano (HBC). Bloccare la secrezione e l'attivazione della MMP-2 durante lo sviluppo del carcinoma mammario può ridurre le metastasi. Il rilevamento della sola MMP-2 attiva o del tasso di pro-MMP-2 e MMP-2 attiva è considerato un indicatore molto sensibile della metastasi del cancro. La modulazione dell'espressione e dell'attivazione della MMP-2 attraverso inibitori e attivatori specifici può quindi fornire un nuovo meccanismo per il trattamento del cancro al seno

Specifications

Product Name
Proteina MMP-2 umana ricombinante
Sinonimi
72 kDa gelatinasi | CLG4 | CLG4A72 kDa collagenasi di tipo IV | collagenasi di tipo IV-A | EC 3.4.24 | EC 3.4.24.24 | Gelatinasi A | matrice metallopeptidasi 2 (gelatinasi A, 72kDa gelatinasi, 72kDa tipo IVcollagenasi) | matrice metalloproteinasi 2 (gelat
Grado
Animal Free, Bioactive, Carrier Free, His Tag
Specifiche e purezza
Senza animali, senza vettore, bioattivo, ≥90% (SDS-PAGE)
Bioattività
Immobilized Recombinant Human MMP-2 Protein (rp181213) at 1.0 μg/mL can bind MMP2 Mouse mAb (Ab115657) with the EC50 of 23.04 ng/mL
Concentrazione di endotossina
<1.0 EU/μg
Sistema di espressione
HEK293
Aminoacidi
1-660 aa
Sequenza
MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGCHHHHHH
Tag proteico
C-His
Numero d'ordine
Peso molecolare previsto
71.8 kDa
SDS-PAGE
70.7 kDa, under reducing conditions
Tipo di molecola
Proteine
Stoccaggio e spedizione
Forma
Liofilizzato
Ricostituzione
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condizioni di conservazione di stoccaggio
Conservare a -20°C, evitando di congelare e scongelare ripetutamente
Spedito in
Cassetta del ghiaccio + cuscini per il ghiaccio
Stabilità e conservazione
Conservare a -20°C per 1 anno. Evitare il ciclo di congelamento/scongelamento.
Immagini

Recombinant Human MMP-2 Protein (rp181213) - ELISA
Immobilized Recombinant Human MMP-2 Protein (rp181213) at 1.0 μg/mL can bind MMP2 Mouse mAb (Ab115657) with the EC50 of 23.04 ng/mL.

Recombinant Human MMP-2 Protein (rp181213) - SDS-PAGE
2 μg/lane of Recombinant Human MMP-2 Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 70.7 kDa.

Documentazione

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificati (CoA, COO, BSE/TSE e tabella di analisi)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

5 results found

Lot NumberCertificate TypeDataOggetto
ZJ25F0724290Certificate of AnalysisMay 20, 2026 rp181213
ZJ24F0606745Certificate of AnalysisJun 14, 2024 rp181213
ZJ24F0606744Certificate of AnalysisJun 14, 2024 rp181213
ZJ24F0606743Certificate of AnalysisJun 14, 2024 rp181213
ZJ24F0606742Certificate of AnalysisJun 14, 2024 rp181213
Domande frequenti e articoli
Calcolatori di soluzioni
Recensioni

Recensioni dei clienti

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.