Recombinant Human MUC-1 Protein

Cat. No.: rp167111
Disponibile su ordine
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. AVI tag ? AVI tag grade — recombinant protein bearing a AVI tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. The AVI tag enables site-specific biotinylation. ≥95%(SDS-PAGE)
Accession #
P15941
Protein Tag
C-His&Avi
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured by its ability to increase beta-catenin levels in the cytoplasm and nucleus of HCT116 human colon adenocarcinoma cells. 0.01-1 ng/mL of Recombinant Human MUC-1 can effectively increase beta-catenin levels.
★
Size
Germania (EU)
USA*
Price
Qty
10μg
rp167111-10μg
Su ordinazione · 8–12 settimane
60,65€
50μg
rp167111-50μg
Su ordinazione · 8–12 settimane
164,78€
100μg
rp167111-100μg
Su ordinazione · 8–12 settimane
251,56€
1mg
rp167111-1mg
Su ordinazione · 8–12 settimane
2.169,26€
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, His Tag, AVI tag, ≥95%(SDS-PAGE) ActiBioPure™,Animal Free,AVI tag,Bioactive,Carrier Free,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human MUC-1 Protein
Sinonimi
Breast carcinoma-associated antigen DF3 | Carcinoma-associated mucin | CD227 antigen | CD227 | DF3 antigen | EMA | Episialin | H23 antigen | H23AG | KL-6 | MAM6 | MUC-1 | MUC1/ZD | mucin 1, cell surface associated | mucin 1, transmembrane | Mucin-1 | Pean
Grado
ActiBioPure™, Animal Free, AVI tag, Bioactive, Carrier Free, High Performance, His Tag
Specifiche e purezza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, His Tag, AVI tag, ≥95%(SDS-PAGE)
Meccanismi biochimici e fisiologici
The alpha subunit has cell adhesive properties. Can act both as an adhesion and an anti-adhesion protein. May provide a protective layer on epithelial cells against bacterial and enzyme attack.The beta subunit contains a C-terminal domain which is involve
Bioattività
Measured by its ability to increase beta-catenin levels in the cytoplasm and nucleus of HCT116 human colon adenocarcinoma cells. 0.01-1 ng/mL of Recombinant Human MUC-1 can effectively increase beta-catenin levels.
Concentrazione di endotossina
<1.0 EU/μg
Aminoacidi
1-380 aa
Sequenza
MTPGTQSPFFLLLLLTVLTVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAVSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPASGSAATWGQDVTSVPVTRPALGSTTPPAHDVTSAPDNKPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS
Numero d'ordine
Peso molecolare previsto
39 kDa
SDS-PAGE
50-55 kDa,under reducing conditions.
Tipo di molecola
Proteine
Stoccaggio e spedizione
Ricostituzione
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Condizioni di conservazione di stoccaggio
Store at -20°C,Avoid repeated freezing and thawing
Spedito in
Ice chest + Ice pads
Stabilità e conservazione
Store at -20~-80℃ long term (1 year). Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.

Documentazione

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificati (CoA, COO, BSE/TSE e tabella di analisi)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Domande frequenti e articoli
Calcolatori di soluzioni
Recensioni

Recensioni dei clienti

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.