Recombinant Human PCNA Protein, >95% (SDS-PAGE)

Cat. No.: rp149860
Disponibile su ordine
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Accession #
P12004
Protein Tag
N-His
Expression system
E. coli
★
Size
Germania (EU)
USA*
Price
Qty
10μg
rp149860-10μg
—
3 Disponibile
173,46€
50μg
rp149860-50μg
—
3 Disponibile
451,14€
100μg
rp149860-100μg
Su ordinazione · 8–12 settimane
694,10€
1mg
rp149860-1mg
Su ordinazione · 8–12 settimane
3.470,87€
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Azide Free,His Tag,PBS Only,≥95%(SDS-PAGE) Animal Free,Azide Free,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Panoramica

Purity:
>95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Function:
This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. Has to be loaded onto DNA in order to be able to stimulate APEX2.
Description:
Proliferating Cell Nuclear Antigen (PCNA) is a protein only expressed in normal proliferate cells and cancer cells. It is central to both DNA replication and repair. One of the well-established functions for PCNA is its role as the processivity factor for DNA polymerase delta and epsilon. PCNA tethers the polymerase catalytic unit to the DNA template for rapid and processive DNA synthesis. Two forms of PCNA exist in cells: (i) a detergent-insoluble trimeric form stably associated with the replicating forks during S phase and (ii) a soluble form in quiescent cells in G1 and G2 phases. PCNA forms a toroidal trimer in S phase with replication factor-C (RF-C) and DNA in an ATP-dependent manner and enables the loading of DNA polymerase delta and epsilon onto the complex. The close association of PCNA with kinase complexes involved in cell cycle machinery indicates that PCNA has a regulatory role in cell cycle progression. PCNA also participates in the processing of branched intermediates that arise during the lagging strand DNA synthesis.


Specifications

Product Name
Recombinant Human PCNA Protein, >95% (SDS-PAGE)
Sinonimi
PCNA, Cyclin, Proliferating cell nuclear antigen | ATLD2 | cb16 | DNA polymerase delta auxiliary protein | etID36690.10 | fa28e03 | fb36g03 | HGCN8729 | MGC8367 | Mutagen-sensitive 209 protein | OTTHUMP00000030189 | OTTHUMP00000030190 | Pcna/cyclin | PCNA
Grado
Animal Free, Azide Free, Carrier Free, His Tag, PBS Only
Specifiche e purezza
Animal Free,Carrier Free,Azide Free,His Tag,PBS Only,≥95%(SDS-PAGE)
La purezza
>95% (SDS-PAGE)
Sistema di espressione
E. coli
Specie
Human
Aminoacidi
1-261aa
Sequenza
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
Tag proteico
N-His
Numero d'ordine
Peso molecolare previsto
32.3 kDa
SDS-PAGE
35.9 kDa, reducing conditions;35.9 kDa,non-reducing condition
Tipo di molecola
Proteine
Stoccaggio e spedizione
Forma
Lyophilized
Ricostituzione
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condizioni di conservazione di stoccaggio
Store at -20°C,Avoid repeated freezing and thawing
Spedito in
Ice chest + Ice pads
Stabilità e conservazione
Store at -20°C stable for 1 year, store at 2-8℃ for 1 month. Avoid freeze / thaw cycle
Immagini

Recombinant PCNA protein (rp149860) - SDS-PAGE
Recombinant PCNA protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 35.9 kDa.

Documentazione

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificati (CoA, COO, BSE/TSE e tabella di analisi)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDataOggetto
ZJ23F1101732Certificate of AnalysisMay 19, 2026 rp149860
ZJ23F1101733Certificate of AnalysisMay 19, 2026 rp149860
ZJ23R1100131Certificate of AnalysisNov 14, 2023 rp149860
Domande frequenti e articoli
Calcolatori di soluzioni
Recensioni

Recensioni dei clienti

Domande frequenti

What is the purity of this product, and how is it determined?
This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.
What does Animal Free mean?
Animal Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
What does Carrier Free mean?
Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
How should this product be stored?
Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.
How is this product shipped?
This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.
What documentation is provided?
Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.