Recombinant Human RUNX3 Protein

Cat. No.: rp192226
Disponibile su ordine
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE) expressed in E. coli; See COA)
Accession #
Q13761
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
★
Size
Germania (EU)
USA*
Price
Qty
10μg
rp192226-10μg
Su ordinazione · 8–12 settimane
78,01€
50μg
rp192226-50μg
Su ordinazione · 8–12 settimane
234,20€
100μg
rp192226-100μg
Su ordinazione · 8–12 settimane
373,04€
1mg
rp192226-1mg
Su ordinazione · 8–12 settimane
2.256,03€
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,His Tag,≥95%(SDS-PAGE),expressed in E. coli; See COA) Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human RUNX3 Protein
Sinonimi
IAML2 | CBFA3 | PEBP2aC | PEBP2A3 | FLJ34510 | MGC16070 | RUNX3 | Oncogene AML-2 | Runt-related transcription factor 3 | Core-binding factor subunit alpha-3 | Acute myeloid leukemia 2 protein | Polyomavirus enhancer-binding protein 2 alpha C subunit | SL3
Grado
Carrier Free, His Tag
Specifiche e purezza
Carrier Free,His Tag,≥95%(SDS-PAGE),expressed in E. coli; See COA)
Meccanismi biochimici e fisiologici
RUNX3 is part of the RUNX family that mediates the expression of genes which participate in cellular differentiation and cell cycle progression. RUNX3 heterodimer and the beta subunit form a complex that binds to the core DNA sequence 5''-PYGPYGGT-3'' fou
Concentrazione di endotossina
<1.0 EU/μg
Aminoacidi
53-186 aa
Sequenza
MHHHHHHRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPRRHRQK
Numero d'ordine
Peso molecolare previsto
15.8 kDa
SDS-PAGE
16.0 kDa, under reducing conditions; 16.0 kDa, under non-reducing conditions.
Tipo di molecola
Proteine
Stoccaggio e spedizione
Concentrazione
expressed in E. coli; See COA)
Condizioni di conservazione di stoccaggio
Store at -20°C,Avoid repeated freezing and thawing
Spedito in
Ice chest + Ice pads
Stabilità e conservazione
Store at -20℃ long term (6 months). Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Immagini
Recombinant Human RUNX3 Protein (rp192226) - SDS-PAGE 
3 μg/lane of  Recombinant Human RUNX3 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 16.0 kDa.

Documentazione

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificati (CoA, COO, BSE/TSE e tabella di analisi)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Calcolatori di soluzioni
Recensioni

Recensioni dei clienti

Domande frequenti

What is the purity of this product, and how is it determined?
This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.
What does Carrier Free mean?
Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
What is His Tag?
His Tag refers to a recombinant protein product fused with the His affinity tag, suitable for recombinant protein expression and affinity purification. The tag enables one-step affinity purification, immobilization or detection without affecting downstream activity in most cases.
How should this product be stored?
Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.
How is this product shipped?
This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.
What documentation is provided?
Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide → View His Tag grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.